LXL04_039335 | RubberDandelionOmics

Gene overview

LXL04_039335

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 3286619-3287308 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_039335|LXL04_039335|OH1004|cDNA

ATGGAGATTCGATGGAGCCGATCAGACTTGGTTCAGCCAGCATCATCGTCTCTTAAAATGATTAGTTTGAAGGATCTCTACAATGGACAATGCTTTGCACCGCTCATAATCAGATCCAAAAATCTTAGAACCTTAAGACTTTTCAGATGTTTCGGAGATTGGGATGACGTTCTGAAACTTGTTAGCAATAACATCAAGGGATTGAACTGGGCACATCTGGAGAGGCTGCAGGTAAGCGACGTTGGACTCGCAGCCCTTTC...

CDS

Download CDS FASTA

690 bp · LXL04_039335|LXL04_039335|OH1004|CDS

ATGGAGATTCGATGGAGCCGATCAGACTTGGTTCAGCCAGCATCATCGTCTCTTAAAATGATTAGTTTGAAGGATCTCTACAATGGACAATGCTTTGCACCGCTCATAATCAGATCCAAAAATCTTAGAACCTTAAGACTTTTCAGATGTTTCGGAGATTGGGATGACGTTCTGAAACTTGTTAGCAATAACATCAAGGGATTGAACTGGGCACATCTGGAGAGGCTGCAGGTAAGCGACGTTGGACTCGCAGCCCTTTC...

Protein

Download Protein FASTA

229 aa · LXL04_039335|LXL04_039335|OH1004|PROTEIN

MEIRWSRSDLVQPASSSLKMISLKDLYNGQCFAPLIIRSKNLRTLRLFRCFGDWDDVLKLVSNNIKGLNWAHLERLQVSDVGLAALSNCQNLEILHLLKTPDCTNSGLTSMAENCKLLRKLHIDGWKTNRIDDEGLIDVAKNCPNLQELVLIGVNPIRASLERFASNCQKLERLALCGSETFGDAEISCIAGKFTALRKLCIKSCPVSDHGMEALALGCPNLVIVKVKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039335`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039335

Location JAJTUU010000010.1:3286619-3287308 (+)

Description Similar to FBL8: Putative F-box/LRR-repeat protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g07400`	Putative F-box/LRR-repeat protein 8.	No verified direct reference in this release
`At5g67250`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g47056`	F-box protein At1g47056.	No verified direct reference in this release
`At3g50080`	F-box/LRR-repeat protein 16.	No verified direct reference in this release
`At4g15475`	F-box/LRR-repeat protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039335 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010225 response to UV-C Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G47056

ath:AT3G50080

ath:AT4G07400

ath:AT4G15475

ath:AT5G67250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.649

Rank 1 · LXL04_039335 · OH-1004

Cytoplasm0.223

Rank 2 · LXL04_039335 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_039335 · OH-1004

Plastid0.048

Rank 4 · LXL04_039335 · OH-1004

Endoplasmic reticulum0.039

Rank 5 · LXL04_039335 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25372.2LRR_FBXL1577-225 aa

PF24758.2LRR_At5g5637085-180 aa

PF29594.1LRR_SKP2131-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039335	`PF25372.2`	LRR_FBXL15	77	225	1.6e-10	40.7
LXL04_039335	`PF24758.2`	LRR_At5g56370	85	180	7.8e-11	42.8
LXL04_039335	`PF29594.1`	LRR_SKP2	131	214	5e-08	33.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9X4`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 8	64.286%	Swiss-Prot	strong database homology
`Q9FE83`	Arabidopsis thaliana	F-box protein SKIP2	64.593%	Swiss-Prot	strong database homology
`Q9C626`	Arabidopsis thaliana	F-box protein At1g47056	62.780%	Swiss-Prot	strong database homology
`Q9SN10`	Arabidopsis thaliana	F-box/LRR-repeat protein 16	58.252%	Swiss-Prot	strong database homology
`Q9C5D2`	Arabidopsis thaliana	F-box/LRR-repeat protein 4	30.698%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card