LXL04_039327 | RubberDandelionOmics

Gene overview

LXL04_039327

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 3132531-3132866 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · LXL04_039327|LXL04_039327|OH1004|cDNA

ATGAAGGGAATTAAGGAAACCCTGCTGGCGCCACGGTTCTACACCACTAATTTCGATGAGATGGAGCAGCTATTTAACACCGAGATGAACAAGAACTTGAACGAAGCTGAATTCGAGGCGTTGTTGCAGGAGTTTAAAACTGATTACAACCAGACACATTTCGTTAGGAACAAGGAGTTTAAAGAACCTGCTGATGGGATTCAGGGTCCTATGAGGCAGATCTTTGTTGAGTTTTTGGAGAGGTCTTGTACAGCTGAGTT...

CDS

Download CDS FASTA

336 bp · LXL04_039327|LXL04_039327|OH1004|CDS

ATGAAGGGAATTAAGGAAACCCTGCTGGCGCCACGGTTCTACACCACTAATTTCGATGAGATGGAGCAGCTATTTAACACCGAGATGAACAAGAACTTGAACGAAGCTGAATTCGAGGCGTTGTTGCAGGAGTTTAAAACTGATTACAACCAGACACATTTCGTTAGGAACAAGGAGTTTAAAGAACCTGCTGATGGGATTCAGGGTCCTATGAGGCAGATCTTTGTTGAGTTTTTGGAGAGGTCTTGTACAGCTGAGTT...

Protein

Download Protein FASTA

111 aa · LXL04_039327|LXL04_039327|OH1004|PROTEIN

MKGIKETLLAPRFYTTNFDEMEQLFNTEMNKNLNEAEFEALLQEFKTDYNQTHFVRNKEFKEPADGIQGPMRQIFVEFLERSCTAEFSGFLLYKELGRRLKVLILTFQLNP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039327`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039327

Location JAJTUU010000010.1:3132531-3132866 (+)

Description Similar to CRD1: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56940`	Catalytic component of the MgProto monomethylester (MgProtoME) cyclase complex that catalyzes the formation of the isocyclic ring in chlorophyll biosynthesis.	Arabidopsis CHL27, located in both envelope and thylakoid membranes, is required for the synthesis of protochlorophyllide.2003 · DOI: 10.1073/pnas.2136793100 Role of Arabidopsis CHL27 protein for photosynthesis, chloroplast development and gene expression profiling.2008 · DOI: 10.1093/pcp/pcn111 Potential roles of YCF54 and ferredoxin-NADPH reductase for magnesium protoporphyrin monomethylester cyclase.2018 · DOI: 10.1111/tpj.13869

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039327 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0015979 photosynthesis Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:1901401 regulation of tetrapyrrole metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G56940

cre:CHLRE_12g510050v5

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_039327 · OH-1004

Nucleus0.377

Rank 2 · LXL04_039327 · OH-1004

Mitochondrion0.128

Rank 3 · LXL04_039327 · OH-1004

Extracellular0.072

Rank 4 · LXL04_039327 · OH-1004

Cell membrane0.058

Rank 5 · LXL04_039327 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M591`	Arabidopsis thaliana	Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic	89.796%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card