LXL04_039298 | RubberDandelionOmics

Gene overview

LXL04_039298

Reference: OH-1004 Chr: JAJTUU010000010.1 Coordinates: 723946-729140 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1809 bp · LXL04_039298|LXL04_039298|OH1004|cDNA

ATGAAAGCGAGCATAAATGCAATGGTTCTTGAAGGATTCTGTCACAGGGCTGAAAATGCATATGATAATAATGTAAGATATTCCAAAAAATCGGAAAAACCAGCCAAAAGTCGAAGAAGCCACCGGCGTGGCTCGGCCACTAGACTCTGCCGCTGGCAAAGTTTGCTGCTGGAGTCCCCCATACCGCGACGTTCGCCAGCGGCAAACTCACCAAATTCGCATACCGCTGGCCCGTTACCGATCATACCTTCCAGTCTTAC...

CDS

Download CDS FASTA

1809 bp · LXL04_039298|LXL04_039298|OH1004|CDS

ATGAAAGCGAGCATAAATGCAATGGTTCTTGAAGGATTCTGTCACAGGGCTGAAAATGCATATGATAATAATGTAAGATATTCCAAAAAATCGGAAAAACCAGCCAAAAGTCGAAGAAGCCACCGGCGTGGCTCGGCCACTAGACTCTGCCGCTGGCAAAGTTTGCTGCTGGAGTCCCCCATACCGCGACGTTCGCCAGCGGCAAACTCACCAAATTCGCATACCGCTGGCCCGTTACCGATCATACCTTCCAGTCTTAC...

Protein

Download Protein FASTA

602 aa · LXL04_039298|LXL04_039298|OH1004|PROTEIN

MKASINAMVLEGFCHRAENAYDNNVRYSKKSEKPAKSRRSHRRGSATRLCRWQSLLLESPIPRRSPAANSPNSHTAGPLPIIPSSLTVFVFLEQTLLNAFKEYDDKNTLALSSTSTSRSFTLKCSARSPSPTASVDHSVKFKEASKDGNLIPLYRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGLKASSVGRYSRIGAQPTMEIVAKENMVTVMDHHEGVKTEEFVEDRMVVPRRIMEQWKPQRIDELPDAFCE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039298`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039298

Location JAJTUU010000010.1:723946-729140 (+)

Description Similar to ASA2: Anthranilate synthase alpha subunit 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57060`	Essential protein.	The Arabidopsis CAP-D proteins are required for correct chromatin organisation, growth and fertility.2013 · DOI: 10.1007/s00412-013-0424-y The condensin complexes play distinct roles to ensure normal chromosome morphogenesis during meiotic division in Arabidopsis.2014 · DOI: 10.1111/tpj.12628
`At2g29690`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	No verified direct reference in this release
`At5g05730`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	A Link between ethylene and auxin uncovered by the characterization of two root-specific ethylene-insensitive mutants in Arabidopsis.2005 · DOI: 10.1105/tpc.105.033365 Arabidopsis ASA1 is important for jasmonate-mediated regulation of auxin biosynthesis and transport during lateral root formation.2009 · DOI: 10.1105/tpc.108.064303

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0826500`	Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	Characterization of rice anthranilate synthase alpha-subunit genes OASA1 and OASA2. Tryptophan accumulation in transgenic rice expressing a feedback-insensitive mutant of OASA1.2001 · DOI: 10.1104/pp.126.4.1493 In vitro reconstitution of rice anthranilate synthase: distinct functional properties of the alpha subunits OASA1 and OASA2.2004 · DOI: 10.1023/b:plan.0000028729.79034.07
`UniProt: A2XNK3`	Part of a heterotetrameric complex that catalyzes the two-step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039298 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0000278 mitotic cell cycle Biological Process

GO:0006325 chromatin organization Biological Process

GO:0007076 mitotic chromosome condensation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010032 meiotic chromosome condensation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT2G29690

ath:AT3G57060

ath:AT5G05730

dosa:Os03g0826500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.449

Rank 1 · LXL04_039298 · OH-1004

Cytoplasm0.361

Rank 2 · LXL04_039298 · OH-1004

Cell membrane0.118

Rank 3 · LXL04_039298 · OH-1004

Endoplasmic reticulum0.102

Rank 4 · LXL04_039298 · OH-1004

Mitochondrion0.060

Rank 5 · LXL04_039298 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12717.14Cnd1352-512 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039298	`PF12717.14`	Cnd1	352	512	5.1e-51	173.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1I9LM04`	Arabidopsis thaliana	Condensin-1 complex subunit CAP-D2	78.846%	Swiss-Prot	weak database homology
`P32069`	Arabidopsis thaliana	Anthranilate synthase alpha subunit 2, chloroplastic	64.629%	Swiss-Prot	weak database homology
`P32068`	Arabidopsis thaliana	Anthranilate synthase alpha subunit 1, chloroplastic	60.833%	Swiss-Prot	weak database homology
`Q94GF1`	Oryza sativa subsp. japonica	Anthranilate synthase alpha subunit 1, chloroplastic	62.201%	Swiss-Prot	weak database homology
`A2XNK3`	Oryza sativa subsp. indica	Anthranilate synthase alpha subunit 1, chloroplastic	62.201%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card