LXL04_039284 | RubberDandelionOmics

Gene overview

LXL04_039284

Reference: OH-1004 Chr: Chr09 Coordinates: 64440146-64480821 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

28062 bp · LXL04_039284|LXL04_039284|OH1004|cDNA

ATGGAGTACACTGATTCGGCAATGACAGAACCAGTAACCAATTTGTGTTCAATCAACCGAAAACCGGAATTCTGCCAAAATTCTGATGTCGATGGGTTCACTAATTATAGCCACTCCATTCACGTGACAGACGCTCCTAATCCAATTGATCATGCACAAGCTGAACTGAAGAATTCGCAGGCTGAACTGAAGAATTCGCAGGGTAAAACATATAGAACAGTCCTTGGTCTTCGATTTTCATTAGACAATCTTCCCACAGA...

CDS

Download CDS FASTA

28062 bp · LXL04_039284|LXL04_039284|OH1004|CDS

ATGGAGTACACTGATTCGGCAATGACAGAACCAGTAACCAATTTGTGTTCAATCAACCGAAAACCGGAATTCTGCCAAAATTCTGATGTCGATGGGTTCACTAATTATAGCCACTCCATTCACGTGACAGACGCTCCTAATCCAATTGATCATGCACAAGCTGAACTGAAGAATTCGCAGGCTGAACTGAAGAATTCGCAGGGTAAAACATATAGAACAGTCCTTGGTCTTCGATTTTCATTAGACAATCTTCCCACAGA...

Protein

Download Protein FASTA

9353 aa · LXL04_039284|LXL04_039284|OH1004|PROTEIN

MEYTDSAMTEPVTNLCSINRKPEFCQNSDVDGFTNYSHSIHVTDAPNPIDHAQAELKNSQAELKNSQGKTYRTVLGLRFSLDNLPTETENSGNPSSNIQFIDNSAFKNTLYTDSSNRLSNLTREIENANLISPVSLNIENHVLTDTHSDKPMDLDNGLEPNPDPQEAYGSILDLNPNYSISALVAEFNRDIKLFSQWGDCDQIRAHWNNLNHTEKEQLLLGLKFRLKPGPKCHAKAETVTNKLKAVQNTRTRKKICSNWM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039284`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039284

Location Chr09:64440146-64480821 (-)

Description Similar to LINE-1 retrotransposable element ORF2 protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039284 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0003723 RNA binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.526

Rank 1 · LXL04_039284 · OH-1004

Nucleus0.319

Rank 2 · LXL04_039284 · OH-1004

Cell membrane0.123

Rank 3 · LXL04_039284 · OH-1004

Mitochondrion0.059

Rank 4 · LXL04_039284 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_039284 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14111.13DUF4283410-485 aa

PF00078.33RVT_11364-1619 aa

PF13966.12zf-RVT1880-1964 aa

PF14111.13DUF42833131-3207 aa

PF00078.33RVT_13921-4121 aa

PF13966.12zf-RVT4409-4493 aa

PF00078.33RVT_15459-5711 aa

PF00078.33RVT_15993-6223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039284	`PF14111.13`	DUF4283	410	485	9.8e-32	109.2
LXL04_039284	`PF00078.33`	RVT_1	1364	1619	3.8e-163	540.1
LXL04_039284	`PF13966.12`	zf-RVT	1880	1964	2.5e-57	192.2
LXL04_039284	`PF14111.13`	DUF4283	3131	3207	9.8e-32	109.2
LXL04_039284	`PF00078.33`	RVT_1	3921	4121	3.8e-163	540.1
LXL04_039284	`PF13966.12`	zf-RVT	4409	4493	2.5e-57	192.2
LXL04_039284	`PF00078.33`	RVT_1	5459	5711	3.8e-163	540.1
LXL04_039284	`PF00078.33`	RVT_1	5993	6223	3.8e-163	540.1
LXL04_039284	`PF14111.13`	DUF4283	7044	7119	9.8e-32	109.2
LXL04_039284	`PF00078.33`	RVT_1	8005	8215	3.8e-163	540.1
LXL04_039284	`PF13966.12`	zf-RVT	8446	8530	2.5e-57	192.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	Putative ribonuclease H protein At1g65750	25.683%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card