Gene Card
Gene overview
cDNA / CDS / Protein Sequences
807 bp · LXL04_039278|LXL04_039278|OH1004|cDNA
ATGATTACAGCTGAGGTTGCAGCAGGGTCAGCAGCATGGCTTGGTAGAGGCCTTTCATGTGTTTGTGCTCATGGAAAAGAAGAAGATGCTTGCCTCTCATTTGATTTGCCTCCTGCCCAGATGTTCCAATCTGATCGTTTTTCTTTGATTCTGACAGGAGGATTGCTTACAGAAGCTGTAAAACAGATTAGACATTGGCACATTGCCTATGATAGTTCAGTTCCAGAACATCAGCAAGCTTTGAGGGCATTATGGAAAGC...
807 bp · LXL04_039278|LXL04_039278|OH1004|CDS
ATGATTACAGCTGAGGTTGCAGCAGGGTCAGCAGCATGGCTTGGTAGAGGCCTTTCATGTGTTTGTGCTCATGGAAAAGAAGAAGATGCTTGCCTCTCATTTGATTTGCCTCCTGCCCAGATGTTCCAATCTGATCGTTTTTCTTTGATTCTGACAGGAGGATTGCTTACAGAAGCTGTAAAACAGATTAGACATTGGCACATTGCCTATGATAGTTCAGTTCCAGAACATCAGCAAGCTTTGAGGGCATTATGGAAAGC...
Protein
Download Protein FASTA268 aa · LXL04_039278|LXL04_039278|OH1004|PROTEIN
MITAEVAAGSAAWLGRGLSCVCAHGKEEDACLSFDLPPAQMFQSDRFSLILTGGLLTEAVKQIRHWHIAYDSSVPEHQQALRALWKAVFLEVALHGLISEQWKEMGWQGKDHSTDFRGGGFISLENLLYFAQNFPKSFQDLLRKQEGDGSMWEYPFDVAGVNITFMLIQMLDLEAVKPRNLVGATFLKFLSDIYTRDNELAFDLLYCIAFKLMDHQSLAMRASYMDFNAVMKSTRHQLETELLEKYITRLEELPSYMLQL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039278 |
|---|---|
| TK1151 ID | TkA04G518480 |
| OH-1004 ID | LXL04_039278 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 97.531 / OH-1004 58.955Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039278 |
|---|---|
| Location | Chr09:64387872-64389290 (+) |
| Description | Similar to elmoA: ELMO domain-containing protein A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007015 actin filament organization Biological Process GO:0030837 negative regulation of actin filament polymerization Biological Process GO:0048870 cell motility Biological Process GO:0050688 regulation of defense response to virus Biological Process GO:0050764 regulation of phagocytosis Biological Process GO:0051607 defense response to virus Biological Process GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0005096 GTPase activator activity Molecular Function GO:0045159 myosin II binding Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0278051 ddi:DDB_G0280179 ddi:DDB_G0280943 ddi:DDB_G0282949 hsa:255520 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04727.19ELMO_CED1267-231 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_039278 | PF04727.19 | ELMO_CED12 | 67 | 231 | 5.1e-45 | 154.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.