LXL04_039268 | RubberDandelionOmics

Gene overview

LXL04_039268

Reference: OH-1004 Chr: Chr09 Coordinates: 64130512-64134202 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2691 bp · LXL04_039268|LXL04_039268|OH1004|cDNA

ATGGTGAAAATATCAAGGGCTACGAGCAACAGTGAGAGTGGtagcaagaagaagaagaagaataagaagaagatgaatcCCAACGCCATAGCTATGAAAATGAAAGCTCCAGTAACAAAACCTAATAACCCCTTTGAAACCATTTGGGCTCGTCGCAAGTTCGACATCCTCGGCAAGAAACGCAAAGGAGAAGAACGCCGTATTGGCCTCGCACGCTCCCTTGCCATTGAAAAGAGAAAGAAAACATTGCTCAAGGATTA...

CDS

Download CDS FASTA

2691 bp · LXL04_039268|LXL04_039268|OH1004|CDS

ATGGTGAAAATATCAAGGGCTACGAGCAACAGTGAGAGTGGTAGCAAGAAGAAGAAGAAGAATAAGAAGAAGATGAATCCCAACGCCATAGCTATGAAAATGAAAGCTCCAGTAACAAAACCTAATAACCCCTTTGAAACCATTTGGGCTCGTCGCAAGTTCGACATCCTCGGCAAGAAACGCAAAGGAGAAGAACGCCGTATTGGCCTCGCACGCTCCCTTGCCATTGAAAAGAGAAAGAAAACATTGCTCAAGGATTA...

Protein

Download Protein FASTA

896 aa · LXL04_039268|LXL04_039268|OH1004|PROTEIN

MVKISRATSNSESGSKKKKKNKKKMNPNAIAMKMKAPVTKPNNPFETIWARRKFDILGKKRKGEERRIGLARSLAIEKRKKTLLKDYERIGKSSVFVDKRIGEQNEELGEFDKAILRSQREMRMKLSKKSRYNLSDGEDDEFETQDFSLYPERDDFEDEVPFDDQDGDANEAQKRSVILKQLSAHGTPGAHATGLEGEENRQKTKKEVYDEIISKSKFFKAEKARDKEENDLLIKKLDEQFTSLSSKVQVVNDLKSKDIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039268`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_039268`
Location	Chr09:64130512-64134202 (+)
Description	Similar to NOP14: Nucleolar protein 14
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039268` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0016020 membrane Cellular Component GO:0030686 90S preribosome Cellular Component GO:0030692 Noc4p-Nop14p complex Cellular Component
KEGG gene cross-reference	ago:AGOS_ADR072C hsa:8602 kla:KLLA0_C16335g mmu:75416 yli:2908498 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_039268 · OH-1004

Cytoplasm0.110

Rank 2 · LXL04_039268 · OH-1004

Mitochondrion0.015

Rank 3 · LXL04_039268 · OH-1004

Cell membrane0.013

Rank 4 · LXL04_039268 · OH-1004

Endoplasmic reticulum0.006

Rank 5 · LXL04_039268 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04147.18Nop1439-881 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039268	`PF04147.18`	Nop14	39	881	3.4e-228	760.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card