LXL04_039191 | RubberDandelionOmics

Gene overview

LXL04_039191

Reference: OH-1004 Chr: Chr09 Coordinates: 61995519-61998759 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1956 bp · LXL04_039191|LXL04_039191|OH1004|cDNA

ATGAATGGTGGTGTTGCATCTCCTAATTCGGATCAATCTGAGTTCGTGGAAGTAGATCCTACAGGGAGATATGGAAGGTATAATGAGATTTTGGGAAAGGGAGCTTCCAAAACAGTTTATAGAGCTTTCGATGAGTATGAAGGCATAGAAGTGGCCTGGAATCAGGTAAAACTGTACGATTTCCTTCAAAGTCCCGAGGATCTTGAGAGGCTATATTGTGAAATCCATCTACTCAAAACCTTGAAACACAACAATATTAT...

CDS

Download CDS FASTA

1956 bp · LXL04_039191|LXL04_039191|OH1004|CDS

ATGAATGGTGGTGTTGCATCTCCTAATTCGGATCAATCTGAGTTCGTGGAAGTAGATCCTACAGGGAGATATGGAAGGTATAATGAGATTTTGGGAAAGGGAGCTTCCAAAACAGTTTATAGAGCTTTCGATGAGTATGAAGGCATAGAAGTGGCCTGGAATCAGGTAAAACTGTACGATTTCCTTCAAAGTCCCGAGGATCTTGAGAGGCTATATTGTGAAATCCATCTACTCAAAACCTTGAAACACAACAATATTAT...

Protein

Download Protein FASTA

651 aa · LXL04_039191|LXL04_039191|OH1004|PROTEIN

MNGGVASPNSDQSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYEGIEVAWNQVKLYDFLQSPEDLERLYCEIHLLKTLKHNNIMKFYTSWVDTGNRNMNFVTEMFTSGTLRQYRQKHRRVNLRAIKHWCRQILKGLLYLHSHDPPVIHRDLKCDNIFVNGNQGEVKIGDLGLAAILRKSHAARCVGTPEFMAPEVYAEEYNELVDIYAFGMCILEMVTFEYPYSECTHPAQIYKKVISGKKPDALYKVKDPEVRQFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039191`
TK1151 ID	TkA04G514560
OH-1004 ID	LXL04_039191
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039191

Location Chr09:61995519-61998759 (+)

Description Similar to WNK1: Serine/threonine-protein kinase WNK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04910`	Regulates flowering time by modulating the photoperiod pathway.	The APRR3 component of the clock-associated APRR1/TOC1 quintet is phosphorylated by a novel protein kinase belonging to the WNK family, the gene for which is also transcribed rhythmically in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf084 Compilation and characterization of a novel WNK family of protein kinases in Arabiodpsis thaliana with reference to circadian rhythms.2002 · DOI: 10.1271/bbb.66.2429 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At3g22420`	Regulates flowering time by modulating the photoperiod pathway.	The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At5g28080`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0572800`	Probable serine/threonine-protein kinase WNK1.	No verified direct reference in this release
`UniProt: A2YMV6`	Probable serine/threonine-protein kinase WNK1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039191 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04910

ath:AT3G22420

ath:AT5G28080

dosa:Os07g0572800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · LXL04_039191 · OH-1004

Nucleus0.406

Rank 2 · LXL04_039191 · OH-1004

Cell membrane0.195

Rank 3 · LXL04_039191 · OH-1004

Golgi apparatus0.061

Rank 4 · LXL04_039191 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_039191 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase28-282 aa

PF07714.24PK_Tyr_Ser-Thr28-264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039191	`PF00069.32`	Pkinase	28	282	6.8e-49	167.3
LXL04_039191	`PF07714.24`	PK_Tyr_Ser-Thr	28	264	3e-32	112.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAV6`	Arabidopsis thaliana	Serine/threonine-protein kinase WNK1	54.469%	Swiss-Prot	strong database homology
`Q8S8Y9`	Arabidopsis thaliana	Serine/threonine-protein kinase WNK2	53.253%	Swiss-Prot	strong database homology
`Q2V338`	Arabidopsis thaliana	Probable serine/threonine-protein kinase WNK9	64.040%	Swiss-Prot	strong database homology
`Q0D598`	Oryza sativa subsp. japonica	Probable serine/threonine-protein kinase WNK1	66.867%	Swiss-Prot	strong database homology
`A2YMV6`	Oryza sativa subsp. indica	Probable serine/threonine-protein kinase WNK1	66.867%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card