LXL04_039180 | RubberDandelionOmics

Gene overview

LXL04_039180

Reference: OH-1004 Chr: Chr09 Coordinates: 61788582-61790741 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

981 bp · LXL04_039180|LXL04_039180|OH1004|cDNA

ATGCAAATGGCGTGTTTTATAACGTCCACCTCCTCATCTCCTACGTTATTTAATTATAACAATTACAATATTAAATTAAAATTGGTAAAATCTATACATTTAAGTCGCAAACGGCGACAGCCTTTTCCCTTGAATCTCGGAATCGTCCTTCTCTctccatcaccaccaccaccaccacccgcAATTCGACGTCGTTCCTTTCTTCTTCGCTGTACTTCATCATCTCTTCATTCCGAAATGGAGTCGATTGCAAGTGAAGG...

CDS

Download CDS FASTA

981 bp · LXL04_039180|LXL04_039180|OH1004|CDS

ATGCAAATGGCGTGTTTTATAACGTCCACCTCCTCATCTCCTACGTTATTTAATTATAACAATTACAATATTAAATTAAAATTGGTAAAATCTATACATTTAAGTCGCAAACGGCGACAGCCTTTTCCCTTGAATCTCGGAATCGTCCTTCTCTCTCCATCACCACCACCACCACCACCCGCAATTCGACGTCGTTCCTTTCTTCTTCGCTGTACTTCATCATCTCTTCATTCCGAAATGGAGTCGATTGCAAGTGAAGG...

Protein

Download Protein FASTA

326 aa · LXL04_039180|LXL04_039180|OH1004|PROTEIN

MQMACFITSTSSSPTLFNYNNYNIKLKLVKSIHLSRKRRQPFPLNLGIVLLSPSPPPPPPAIRRRSFLLRCTSSSLHSEMESIASEGVYPLHRSKTIHLVRHAQGIHNVAGEKDHSAYLSEQLFDAQLTPLGWQQVDNLRKHVHASGLHKRIELVVVSPLLRTMQTAVGAFGGEGGVDGINPLMTENAGKSNRPSISSLNCPPFIAMELCREHLIENEEDVLWTADTREKNEDVAGRGVKFIKWLLTREEKEIAVVTHSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039180`
TK1151 ID	TkA04G513380
OH-1004 ID	LXL04_039180
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039180

Location Chr09:61788582-61790741 (+)

Description Similar to At5g64460: Phosphoglycerate mutase-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64460`	May play a role in carbohydrates metabolism.	No verified direct reference in this release
`At1g58280`	May play a role in carbohydrates metabolism.	No verified direct reference in this release
`At2g17280`	May play a role in carbohydrates metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039180 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0016791 phosphatase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G58280

ath:AT2G17280

ath:AT5G64460

cal:CAALFM_CR10210WA

spo:2541759

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.912

Rank 1 · LXL04_039180 · OH-1004

Mitochondrion0.088

Rank 2 · LXL04_039180 · OH-1004

Nucleus0.056

Rank 3 · LXL04_039180 · OH-1004

Cytoplasm0.036

Rank 4 · LXL04_039180 · OH-1004

Peroxisome0.013

Rank 5 · LXL04_039180 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00300.28His_Phos_197-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039180	`PF00300.28`	His_Phos_1	97	168	3.8e-11	43.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGF0`	Arabidopsis thaliana	Phosphoglycerate mutase-like protein 1	61.314%	Swiss-Prot	strong database homology
`F4IBB2`	Arabidopsis thaliana	Phosphoglycerate mutase-like protein 2	55.172%	Swiss-Prot	strong database homology
`Q8GY96`	Arabidopsis thaliana	Phosphoglycerate mutase-like protein	59.470%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card