LXL04_039154 | RubberDandelionOmics

Gene overview

LXL04_039154

Reference: OH-1004 Chr: Chr09 Coordinates: 60946473-60949782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1776 bp · LXL04_039154|LXL04_039154|OH1004|cDNA

ATGGTGTTAGTGTCATCTGCAAGAGATTATATAAATCGAATGCTGCAAGATATTTCTGGCATGAAAGTTCTTATACTTGATTCCCAAACGGTTAGTGTTGTTAGTGTGGTGTATTCTCAGTCAGAACTTCTGCAAAAAGAAGTGTTTTTGGTAGAATTGGTTGATGCCATCTCCATGTCAAAGGAGTCCATGTCACATCTCAAAGCAGTTTATTTTCTGCGGCCCACATCAGAAAATATTCAGCATTTGAAACGTCAACT...

CDS

Download CDS FASTA

1707 bp · LXL04_039154|LXL04_039154|OH1004|CDS

ATGGTGTTAGTGTCATCTGCAAGAGATTATATAAATCGAATGCTGCAAGATATTTCTGGCATGAAAGTTCTTATACTTGATTCCCAAACGGTTAGTGTTGTTAGTGTGGTGTATTCTCAGTCAGAACTTCTGCAAAAAGAAGTGTTTTTGGTAGAATTGGTTGATGCCATCTCCATGTCAAAGGAGTCCATGTCACATCTCAAAGCAGTTTATTTTCTGCGGCCCACATCAGAAAATATTCAGCATTTGAAACGTCAACT...

Protein

Download Protein FASTA

568 aa · LXL04_039154|LXL04_039154|OH1004|PROTEIN

MVLVSSARDYINRMLQDISGMKVLILDSQTVSVVSVVYSQSELLQKEVFLVELVDAISMSKESMSHLKAVYFLRPTSENIQHLKRQLAKPRFGEYNLFFSNMLNTTQLHILADSDEHEVVQQVQEFFADFVANEPYHFSLNTPSNYMYMLPAVIDPPNLQNYCDRIVDGVAAIFLAFKRRPVIRYSRTSDIAKRIAQEASKLMYQQESGLFDFRRTEISPLLLVIDRRDDPVTPLLNQWTYQAMVHELIGIKDNKVDLGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039154`
TK1151 ID	TkA04G509600
OH-1004 ID	LXL04_039154
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.220 / OH-1004 98.768 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039154

Location Chr09:60946473-60949782 (-)

Description Similar to VPS45: Vacuolar protein sorting-associated protein 45 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g77140`	Involved in the protein transport to the vacuole, probably at the level of vesicle fusion at the trans-Golgi network (TGN) and not in transport from the TGN to the prevacuolar compartment, by promoting the recycling of vacuolar sorting receptors back to the TGN.	AtVPS45 is a positive regulator of the SYP41/SYP61/VTI12 SNARE complex involved in trafficking of vacuolar cargo.2009 · DOI: 10.1104/pp.108.134361 Cell polarity and patterning by PIN trafficking through early endosomal compartments in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pgen.1003540

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039154 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009846 pollen germination Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0031338 regulation of vesicle fusion Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005769 early endosome Cellular Component

KEGG gene cross-reference

ath:AT1G77140

ddi:DDB_G0290213

hsa:11311

mmu:22365

rno:64516

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.669

Rank 1 · LXL04_039154 · OH-1004

Nucleus0.204

Rank 2 · LXL04_039154 · OH-1004

Cell membrane0.141

Rank 3 · LXL04_039154 · OH-1004

Golgi apparatus0.140

Rank 4 · LXL04_039154 · OH-1004

Lysosome / Vacuole0.074

Rank 5 · LXL04_039154 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00995.29Sec122-553 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039154	`PF00995.29`	Sec1	22	553	1.1e-122	411.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49048`	Arabidopsis thaliana	Vacuolar protein sorting-associated protein 45 homolog	83.831%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card