LXL04_039138 | RubberDandelionOmics

Gene overview

LXL04_039138

Reference: OH-1004 Chr: Chr09 Coordinates: 60398982-60400301 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1320 bp · LXL04_039138|LXL04_039138|OH1004|cDNA

ATGGACTCGACCATCTTTGCTTTCTTCTTCATTGCTTTTCTTTCGACCACAAGAGCTTTTGATCCATGTCCATATTTAAAACCCAAATCGGATGGCTCAGATCTCTCTATCATCCACATCTCCGGTAAATGTTCACCATTCAACTCACCCAAACCGTCATCCTCATGGAGCACCACGGTCCTCAACATGGCCTCCAACGACCATCAAAGGCTAACCTTCTTATCGAGCATGGTTGCCAACAAGCCTATAACTTCGGTGCC...

CDS

Download CDS FASTA

1320 bp · LXL04_039138|LXL04_039138|OH1004|CDS

ATGGACTCGACCATCTTTGCTTTCTTCTTCATTGCTTTTCTTTCGACCACAAGAGCTTTTGATCCATGTCCATATTTAAAACCCAAATCGGATGGCTCAGATCTCTCTATCATCCACATCTCCGGTAAATGTTCACCATTCAACTCACCCAAACCGTCATCCTCATGGAGCACCACGGTCCTCAACATGGCCTCCAACGACCATCAAAGGCTAACCTTCTTATCGAGCATGGTTGCCAACAAGCCTATAACTTCGGTGCC...

Protein

Download Protein FASTA

439 aa · LXL04_039138|LXL04_039138|OH1004|PROTEIN

MDSTIFAFFFIAFLSTTRAFDPCPYLKPKSDGSDLSIIHISGKCSPFNSPKPSSSWSTTVLNMASNDHQRLTFLSSMVANKPITSVPIAPGQVINIGNYVARVKLGTPGQLMFMVLDISADLAWVPCTGCTGCSSTLFSPNTSITYGPLDCTSSECVQAHGLSCPMSGPDSCLFNQSYGGDSSFLATLSHDFLQLANDTFPSYVFGCIGSVSGKSIPPQGLLGLGRGSMSILAQSGSFYSGVFSYCLPSFRSYYFSGSLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039138`
TK1151 ID	TkA04G508050
OH-1004 ID	LXL04_039138
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039138

Location Chr09:60398982-60400301 (+)

Description Similar to AED3: Aspartyl protease AED3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09750`	Aspartyl protease AED3.	No verified direct reference in this release
`At5g10770`	Probably not redundant with AED1 and not involved in restriction of salicylic acid (SA) or systemic acquired resistance (SAR) signaling.	No verified direct reference in this release
`At1g01300`	Aspartyl protease.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186900`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01300

ath:AT1G09750

ath:AT5G10770

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.452

Rank 1 · LXL04_039138 · OH-1004

Cell membrane0.221

Rank 2 · LXL04_039138 · OH-1004

Endoplasmic reticulum0.120

Rank 3 · LXL04_039138 · OH-1004

Cytoplasm0.094

Rank 4 · LXL04_039138 · OH-1004

Lysosome / Vacuole0.065

Rank 5 · LXL04_039138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00026.29Asp98-435 aa

PF14543.12TAXi_N99-262 aa

PF14541.12TAXi_C285-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039138	`PF00026.29`	Asp	98	435	1.5e-12	48.4
LXL04_039138	`PF14543.12`	TAXi_N	99	262	7.1e-31	108.5
LXL04_039138	`PF14541.12`	TAXi_C	285	434	3.3e-25	89.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04496`	Arabidopsis thaliana	Aspartyl protease AED3	62.676%	Swiss-Prot	strong database homology
`Q8S9J6`	Arabidopsis thaliana	Aspartyl protease family protein At5g10770	31.395%	Swiss-Prot	moderate database homology
`Q9LNJ3`	Arabidopsis thaliana	Aspartyl protease family protein 2	32.308%	Swiss-Prot	moderate database homology
`Q6F4N5`	Oryza sativa subsp. japonica	Aspartyl protease 25	51.456%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card