RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_039137
Reference: OH-1004 Chr: Chr09 Coordinates: 60138157-60146002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2484 bp · LXL04_039137|LXL04_039137|OH1004|cDNA

ATGCCTGTTGGAAGGAATCTAGGGCTTCCAAGCCTGGTGGTCCTGGTAGTGATATTCGTGATATTGCCGGTGGTCGGCTTTGTTATCCGCAGAAAATTGCGACATGCGGCGGCGAGGAACGAGGAGATTAAGAAACTTTTGATATTTGCATCGGAAGAGGCAGCTAGGGCTGAGATTGAGGCTACAGATGGATACTTTTTCACGGCGAACACTAGCTCGTCGATTCCTCCTCCAAATTCAGCCTGGGCACCGGCTCCAGA...

CDS

Download CDS FASTA

2484 bp · LXL04_039137|LXL04_039137|OH1004|CDS

ATGCCTGTTGGAAGGAATCTAGGGCTTCCAAGCCTGGTGGTCCTGGTAGTGATATTCGTGATATTGCCGGTGGTCGGCTTTGTTATCCGCAGAAAATTGCGACATGCGGCGGCGAGGAACGAGGAGATTAAGAAACTTTTGATATTTGCATCGGAAGAGGCAGCTAGGGCTGAGATTGAGGCTACAGATGGATACTTTTTCACGGCGAACACTAGCTCGTCGATTCCTCCTCCAAATTCAGCCTGGGCACCGGCTCCAGA...

Protein

Download Protein FASTA

827 aa · LXL04_039137|LXL04_039137|OH1004|PROTEIN

MPVGRNLGLPSLVVLVVIFVILPVVGFVIRRKLRHAAARNEEIKKLLIFASEEAARAEIEATDGYFFTANTSSSIPPPNSAWAPAPESAWVQPRASVPLVSSLKPPYQCAVCFSPTSTRCAKCKAVRYCSGRCQIVHWRQGHKDECRPYVGTKDVATSCLKKEDDKDSNKAEFHEPETDSFTQSASDTSPSEESCAFSSTSRSSAETSSVSSGESDDFVSVQFQSTKVKPSNEDTTSSDFWSGTIDSKKSTIDETSSNGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_039137
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_039137
LocationChr09:60138157-60146002 (+)
DescriptionSimilar to UBP17: Ubiquitin carboxyl-terminal hydrolase 17
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g65450 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
At4g24560 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.
Ubiquitin-specific protease16 modulates salt tolerance in Arabidopsis by regulating Na(+)/H(+) antiport activity and serine hydroxymethyltransferase stability.2012 · DOI: 10.1105/tpc.112.106393
UBIQUITIN-SPECIFIC PROTEASE16 interacts with a HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN27 and modulates cadmium tolerance.2013 · DOI: 10.4161/psb.25680
At1g17110 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin.
Functional characterization of the Arabidopsis ubiquitin-specific protease gene family reveals specific role and redundancy of individual members in development.2008 · DOI: 10.1111/j.1365-313x.2008.03557.x
The ubiquitin receptor DA1 regulates seed and organ size by modulating the stability of the ubiquitin-specific protease UBP15/SOD2 in Arabidopsis.2014 · DOI: 10.1105/tpc.114.122663
At2g24640 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release
At4g31670 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_039137 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006508 proteolysis Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009908 flower development Biological Process
GO:0010154 fruit development Biological Process
GO:0016579 protein deubiquitination Biological Process
GO:0031647 regulation of protein stability Biological Process
GO:0048364 root development Biological Process
GO:0048366 leaf development Biological Process
GO:0048367 shoot system development Biological Process
GO:0051301 cell division Biological Process
GO:1901000 regulation of response to salt stress Biological Process
GO:0005576 extracellular region Cellular Component
KEGG gene cross-reference
ath:AT1G17110
ath:AT2G24640
ath:AT4G24560
ath:AT5G65450
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.434
Rank 1 · LXL04_039137 · OH-1004
Nucleus0.402
Rank 2 · LXL04_039137 · OH-1004
Cell membrane0.111
Rank 3 · LXL04_039137 · OH-1004
Mitochondrion0.100
Rank 4 · LXL04_039137 · OH-1004
Endoplasmic reticulum0.088
Rank 5 · LXL04_039137 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01753.25zf-MYND109-146 aa
PF00443.36UCH377-682 aa
PF13423.13UCH_1378-664 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_039137PF01753.25zf-MYND1091461.6e-0835.1
LXL04_039137PF00443.36UCH3776824.2e-54184.5
LXL04_039137PF13423.13UCH_13786641.1e-2488.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FKP5Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1744.690%Swiss-Protmoderate database homology
Q9SB51Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1655.963%Swiss-Protmoderate database homology
Q9FPS9Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1537.271%Swiss-Protmoderate database homology
Q9SJA1Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1947.564%Swiss-Protmoderate database homology
Q67XW5Arabidopsis thalianaUbiquitin carboxyl-terminal hydrolase 1852.853%Swiss-Protweak database homology

JBrowse

View in Genome Browser