LXL04_038925 | RubberDandelionOmics

Gene overview

LXL04_038925

Reference: OH-1004 Chr: Chr09 Coordinates: 53447687-53450841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1749 bp · LXL04_038925|LXL04_038925|OH1004|cDNA

ATGGCTCCGACCAGCCTTACGACCATATGCTTATTAGTATACTTGTCTTTTGGGGCGTTTTGGAGGTCCGTTAGGGCCAAAGACGTTCCATATAATTGGGAAGTCATGTACATGAGCGGTGCCCCCGACTGTATAGAAAAGGACCATATCATTGGCATAAACGGGCGGTTTCCTGGTCCTCCCATCAATGCTCGAGTTGGAGACAATGTTGTTGTGTATCTTACAAACAAGCTCCATGATGAAGGAGTTGTTATCCATTG...

CDS

Download CDS FASTA

1749 bp · LXL04_038925|LXL04_038925|OH1004|CDS

ATGGCTCCGACCAGCCTTACGACCATATGCTTATTAGTATACTTGTCTTTTGGGGCGTTTTGGAGGTCCGTTAGGGCCAAAGACGTTCCATATAATTGGGAAGTCATGTACATGAGCGGTGCCCCCGACTGTATAGAAAAGGACCATATCATTGGCATAAACGGGCGGTTTCCTGGTCCTCCCATCAATGCTCGAGTTGGAGACAATGTTGTTGTGTATCTTACAAACAAGCTCCATGATGAAGGAGTTGTTATCCATTG...

Protein

Download Protein FASTA

582 aa · LXL04_038925|LXL04_038925|OH1004|PROTEIN

MAPTSLTTICLLVYLSFGAFWRSVRAKDVPYNWEVMYMSGAPDCIEKDHIIGINGRFPGPPINARVGDNVVVYLTNKLHDEGVVIHWHGIRQLETPWADGTASISQCPIKPGETFKYNFTVDKAGTYFYHGHLGMQRSAGLYGMLIVDVEEGKKEPFHYDGEFSLLLSDWWHKGIEEQEKDLDATPMRWIGEAQSLLINGRGQYSCTLTVPANSKNSKGVPGCKFTGKEQCAPNILDVEPGKTYRLRVASTTALASLNVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038925`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_038925`
Location	Chr09:53447687-53450841 (+)
Description	Similar to AAO: L-ascorbate oxidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038925` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009615 response to virus Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0019854 L-ascorbic acid catabolic process Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0050687 negative regulation of defense response to virus Biological Process GO:0005576 extracellular region Cellular Component GO:0009506 plasmodesma Cellular Component GO:0005507 copper ion binding Molecular Function GO:0008447 L-ascorbate oxidase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function
KEGG gene cross-reference	csv:101215231 nta:107826841 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.438

Rank 1 · LXL04_038925 · OH-1004

Cell membrane0.233

Rank 2 · LXL04_038925 · OH-1004

Golgi apparatus0.107

Rank 3 · LXL04_038925 · OH-1004

Lysosome / Vacuole0.105

Rank 4 · LXL04_038925 · OH-1004

Cytoplasm0.102

Rank 5 · LXL04_038925 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732.22Cu-oxidase_337-150 aa

PF00394.29Cu-oxidase163-331 aa

PF07731.21Cu-oxidase_2443-555 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038925	`PF07732.22`	Cu-oxidase_3	37	150	2.4e-41	141.3
LXL04_038925	`PF00394.29`	Cu-oxidase	163	331	1.8e-40	139.3
LXL04_038925	`PF07731.21`	Cu-oxidase_2	443	555	7e-41	139.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card