LXL04_038922 | RubberDandelionOmics

Gene overview

LXL04_038922

Reference: OH-1004 Chr: Chr09 Coordinates: 53378436-53379778 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · LXL04_038922|LXL04_038922|OH1004|cDNA

ATGGCCGAAAACAATGTTCCAATTACTACTCAACCAGAGATACAATTAAGAGTTGGAATTAACTTGCTAATTGTTTCTCGTTCTTGTTTCCAAAAGGTTCAGAGTGAACAAGAGAGGTTAAAGTACCTACAATTCGTGCAAGTAGCACTACTCCACGCAGTTGTTTATGCATCAAGAGTCTATGGCTACGCTAAAGACAACTCTGGTCCCCTAAAACCTGGCGTAGAGACAATAGAAGGCACTCTCAAGACTGTTGTGGG...

CDS

Download CDS FASTA

690 bp · LXL04_038922|LXL04_038922|OH1004|CDS

ATGGCCGAAAACAATGTTCCAATTACTACTCAACCAGAGATACAATTAAGAGTTGGAATTAACTTGCTAATTGTTTCTCGTTCTTGTTTCCAAAAGGTTCAGAGTGAACAAGAGAGGTTAAAGTACCTACAATTCGTGCAAGTAGCACTACTCCACGCAGTTGTTTATGCATCAAGAGTCTATGGCTACGCTAAAGACAACTCTGGTCCCCTAAAACCTGGCGTAGAGACAATAGAAGGCACTCTCAAGACTGTTGTGGG...

Protein

Download Protein FASTA

229 aa · LXL04_038922|LXL04_038922|OH1004|PROTEIN

MAENNVPITTQPEIQLRVGINLLIVSRSCFQKVQSEQERLKYLQFVQVALLHAVVYASRVYGYAKDNSGPLKPGVETIEGTLKTVVGPAYDKFYDVPVEVLKFVDRKVDESVTIFDSRVPPLLKEVKTAGMMETASGLAKTAYTKIEPAAKGLYVKYEPVAEQYAASAWHSLNQLPLFLKVAKVVVPTAAYYSEKYNQTVQQSAEKGYKVSSYLPLVPTERIAKVFNNV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038922`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038922

Location Chr09:53378436-53379778 (-)

Description Similar to At3g05500: REF/SRPP-like protein At3g05500

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05500`	REF/SRPP-like protein At3g05500.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y0H2`	REF/SRPP-like protein OsI_017815.	No verified direct reference in this release
`Os05g0151300`	REF/SRPP-like protein Os05g0151300/LOC_Os05g05940.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038922 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0019915 lipid storage Biological Process

GO:0034389 lipid droplet organization Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0080186 developmental vegetative growth Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005811 lipid droplet Cellular Component

KEGG gene cross-reference

ath:AT3G05500

dosa:Os05g0151300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.438

Rank 1 · LXL04_038922 · OH-1004

Nucleus0.201

Rank 2 · LXL04_038922 · OH-1004

Mitochondrion0.191

Rank 3 · LXL04_038922 · OH-1004

Cell membrane0.191

Rank 4 · LXL04_038922 · OH-1004

Endoplasmic reticulum0.140

Rank 5 · LXL04_038922 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05755.18REF35-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038922	`PF05755.18`	REF	35	227	1.4e-75	254.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA63`	Arabidopsis thaliana	REF/SRPP-like protein At3g05500	58.605%	Swiss-Prot	strong database homology
`A2Y0H2`	Oryza sativa subsp. indica	REF/SRPP-like protein OsI_017815	46.809%	Swiss-Prot	moderate database homology
`Q9FRA7`	Oryza sativa subsp. japonica	REF/SRPP-like protein Os05g0151300/LOC_Os05g05940	46.809%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card