LXL04_038861 | RubberDandelionOmics

Gene overview

LXL04_038861

Reference: OH-1004 Chr: Chr09 Coordinates: 52096436-52097464 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

585 bp · LXL04_038861|LXL04_038861|OH1004|cDNA

ATGTTTTTGGTGGATTGGTTCTATGGAGTTCTGGCATCGCTAGGTCTATGGCAAAAGGAGGCTAAGATCTTGTTTTTAGGGCTCGATAATGCCGGCAAAACCACTTTGCTTCATATGTTGAAAGACGAGAGACTCGTTCAGCACCAGCCAACACAGTATCCGACGTCCGAAGAACTGAGTATTGGTAAAATTAAGTTCAAAGCCTTCGATTTAGGAGGGCATCAGATCGCTCGTAGAGTCTGGAAAGATTACTACGCCAA...

CDS

Download CDS FASTA

585 bp · LXL04_038861|LXL04_038861|OH1004|CDS

ATGTTTTTGGTGGATTGGTTCTATGGAGTTCTGGCATCGCTAGGTCTATGGCAAAAGGAGGCTAAGATCTTGTTTTTAGGGCTCGATAATGCCGGCAAAACCACTTTGCTTCATATGTTGAAAGACGAGAGACTCGTTCAGCACCAGCCAACACAGTATCCGACGTCCGAAGAACTGAGTATTGGTAAAATTAAGTTCAAAGCCTTCGATTTAGGAGGGCATCAGATCGCTCGTAGAGTCTGGAAAGATTACTACGCCAA...

Protein

Download Protein FASTA

194 aa · LXL04_038861|LXL04_038861|OH1004|PROTEIN

MFLVDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAFDKDRFAESKKELDALLSDESLASVPFLVLGNKIDIPYAASEDELRYYLGLTGLTTGKGKVNLENSSGVRPLEVFMCSIVRKMGYGDGFKWVSQYIK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038861`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038861

Location Chr09:52096436-52097464 (+)

Description Similar to SAR1A: GTP-binding protein SAR1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02080`	Small GTPase that cycles between an active GTP-bound and an inactive GDP-bound state and mainly functions in vesicle-mediated endoplasmic reticulum (ER) to Golgi transport.	No verified direct reference in this release
`At1g56330`	Small GTPase that cycles between an active GTP-bound and an inactive GDP-bound state and mainly functions in vesicle-mediated endoplasmic reticulum (ER) to Golgi transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038861 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0003400 regulation of COPII vesicle coating Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009555 pollen development Biological Process

GO:0016050 vesicle organization Biological Process

GO:0061024 membrane organization Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030127 COPII vesicle coat Cellular Component

KEGG gene cross-reference

ath:AT1G56330

ath:AT4G02080

sly:543958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.493

Rank 1 · LXL04_038861 · OH-1004

Endoplasmic reticulum0.324

Rank 2 · LXL04_038861 · OH-1004

Cytoplasm0.257

Rank 3 · LXL04_038861 · OH-1004

Cell membrane0.119

Rank 4 · LXL04_038861 · OH-1004

Lysosome / Vacuole0.095

Rank 5 · LXL04_038861 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf8-193 aa

PF09439.17SRPRB19-143 aa

PF08477.20Roc22-132 aa

PF01926.30MMR_HSR122-130 aa

PF00071.29Ras22-134 aa

PF00503.27G-alpha50-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038861	`PF00025.28`	Arf	8	193	1.1e-62	211.3
LXL04_038861	`PF09439.17`	SRPRB	19	143	2.3e-07	31.1
LXL04_038861	`PF08477.20`	Roc	22	132	2.4e-08	34.9
LXL04_038861	`PF01926.30`	MMR_HSR1	22	130	5.9e-07	30.3
LXL04_038861	`PF00071.29`	Ras	22	134	1.5e-06	28.6
LXL04_038861	`PF00503.27`	G-alpha	50	133	6.3e-12	46.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04834`	Arabidopsis thaliana	Small COPII coat GTPase SAR1A	92.268%	Swiss-Prot	strong database homology
`Q01474`	Arabidopsis thaliana	Small COPII coat GTPase SAR1B	90.206%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card