LXL04_038741 | RubberDandelionOmics

Gene overview

LXL04_038741

Reference: OH-1004 Chr: Chr09 Coordinates: 49316158-49317550 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

306 bp · LXL04_038741|LXL04_038741|OH1004|cDNA

ATGATTGATCATCCAACACCAACCAGAGCTGAAGTTTCTAACATTGCCATAACAGTAAGACAAGGTGCTGAGGCTATAATGCTTTCTGGGGAAAGTGCACCTGGACAGCAATTGGAAACCATGTTGCATTTACAGTTGGTGGTTCAAATGCGCATTTCAATAAGGCTTCTTGCTGATGCATCTACTTCATTTGAAAAGGACTGTGTAAGAGGCATTCAAACCAACAGGGAAAGAATCTCAAAACTATTGCATgagTCACT...

CDS

Download CDS FASTA

306 bp · LXL04_038741|LXL04_038741|OH1004|CDS

ATGATTGATCATCCAACACCAACCAGAGCTGAAGTTTCTAACATTGCCATAACAGTAAGACAAGGTGCTGAGGCTATAATGCTTTCTGGGGAAAGTGCACCTGGACAGCAATTGGAAACCATGTTGCATTTACAGTTGGTGGTTCAAATGCGCATTTCAATAAGGCTTCTTGCTGATGCATCTACTTCATTTGAAAAGGACTGTGTAAGAGGCATTCAAACCAACAGGGAAAGAATCTCAAAACTATTGCATGAGTCACT...

Protein

Download Protein FASTA

101 aa · LXL04_038741|LXL04_038741|OH1004|PROTEIN

MIDHPTPTRAEVSNIAITVRQGAEAIMLSGESAPGQQLETMLHLQLVVQMRISIRLLADASTSFEKDCVRGIQTNRERISKLLHESLMFVTSLNPLTPFEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038741`
TK1151 ID	TkA04G460950
OH-1004 ID	LXL04_038741
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.956 / OH-1004 95.050 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038741

Location Chr09:49316158-49317550 (+)

Description Similar to FUM2: Fumarate hydratase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50950`	Cytosolic fumarate hydratase that catalyzes the reversible stereospecific interconversion of fumarate to L-malate.	Arabidopsis has a cytosolic fumarase required for the massive allocation of photosynthate into fumaric acid and for rapid plant growth on high nitrogen.2010 · DOI: 10.1111/j.1365-313x.2010.04189.x FUM2, a Cytosolic Fumarase, Is Essential for Acclimation to Low Temperature in Arabidopsis thaliana.2016 · DOI: 10.1104/pp.16.00852 The complex allosteric and redox regulation of the fumarate hydratase and malate dehydratase reactions of Arabidopsis thaliana Fumarase 1 and 2 gives clues for understanding the massive accumulation of fumarate.2018 · DOI: 10.1111/febs.14483
`At2g47510`	Catalyzes the reversible stereospecific interconversion of fumarate to L-malate.	The complex allosteric and redox regulation of the fumarate hydratase and malate dehydratase reactions of Arabidopsis thaliana Fumarase 1 and 2 gives clues for understanding the massive accumulation of fumarate.2018 · DOI: 10.1111/febs.14483
`At1g32440`	Required for plastidial pyruvate kinase activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038741 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006106 fumarate metabolic process Biological Process

GO:0006108 malate metabolic process Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009631 cold acclimation Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010431 seed maturation Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0048868 pollen tube development Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G32440

ath:AT2G47510

ath:AT5G50950

ddi:DDB_G0280495

nta:107822892

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.319

Rank 1 · LXL04_038741 · OH-1004

Cytoplasm0.315

Rank 2 · LXL04_038741 · OH-1004

Mitochondrion0.249

Rank 3 · LXL04_038741 · OH-1004

Plastid0.095

Rank 4 · LXL04_038741 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_038741 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00224.28PK1-36 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038741	`PF00224.28`	PK	1	36	8.5e-09	35.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI53`	Arabidopsis thaliana	Fumarate hydratase 2	77.083%	Swiss-Prot	weak database homology
`P93033`	Arabidopsis thaliana	Fumarate hydratase 1, mitochondrial	75.000%	Swiss-Prot	weak database homology
`Q93Z53`	Arabidopsis thaliana	Plastidial pyruvate kinase 3, chloroplastic	47.826%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card