LXL04_038740 | RubberDandelionOmics

Gene overview

LXL04_038740

Reference: OH-1004 Chr: Chr09 Coordinates: 49270429-49274737 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2169 bp · LXL04_038740|LXL04_038740|OH1004|cDNA

ATGCTTCACCAGACAGACCACGATAGAACGCCAGGCATTCGGTCACAATCATCGTCCCCATCATATTTGATAAACGAACACGTGTATGACCACCGGAGCAAACCGATCAGCTGTGGTGGCGAAATGGACGATGAAACTAACCCGATTTCGTTCACAACTGAATGTTACGCATGCACTCAAGTGGGTGTTCCGGTGTTCCACTCCACGAGCTGCGACCAAGCTCAGCAACCGGAATGGGAAGCCTCCGCCGGGTCTTCCCT...

CDS

Download CDS FASTA

2169 bp · LXL04_038740|LXL04_038740|OH1004|CDS

ATGCTTCACCAGACAGACCACGATAGAACGCCAGGCATTCGGTCACAATCATCGTCCCCATCATATTTGATAAACGAACACGTGTATGACCACCGGAGCAAACCGATCAGCTGTGGTGGCGAAATGGACGATGAAACTAACCCGATTTCGTTCACAACTGAATGTTACGCATGCACTCAAGTGGGTGTTCCGGTGTTCCACTCCACGAGCTGCGACCAAGCTCAGCAACCGGAATGGGAAGCCTCCGCCGGGTCTTCCCT...

Protein

Download Protein FASTA

722 aa · LXL04_038740|LXL04_038740|OH1004|PROTEIN

MLHQTDHDRTPGIRSQSSSPSYLINEHVYDHRSKPISCGGEMDDETNPISFTTECYACTQVGVPVFHSTSCDQAQQPEWEASAGSSLIPIRNRAGSKIIKNRASAGKRGSPSSGVFRRVYDPRSKGVQRWNRFVLLARGMALAVDPLFFYVLSIGRGGTPCLYMDGGLVVVVVAMRTVIDCFHVVHIWLQFRVAYVSRESLVVGCGKLVWDPNSIAYRYVRSLKGFWYDAFVILPIPQIVFLLLLPRLIREDRIKEIMTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038740`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038740

Location Chr09:49270429-49274737 (-)

Description Similar to CNGC2: Cyclic nucleotide-gated ion channel 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15410`	Acts as a cyclic nucleotide-gated ion channel.	The Arabidopsis dnd1 "defense, no death" gene encodes a mutated cyclic nucleotide-gated ion channel.2000 · DOI: 10.1073/pnas.150005697 Developmentally regulated expression of a cyclic nucleotide-gated ion channel from Arabidopsis indicates its involvement in programmed cell death.2001 · DOI: 10.1007/s004250000510
`At5g54250`	Acts as a cyclic nucleotide-gated ion channel.	HLM1, an essential signaling component in the hypersensitive response, is a member of the cyclic nucleotide-gated channel ion channel family.2003 · DOI: 10.1105/tpc.006999
`At1g15990`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At1g19780`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30560`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038740 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007263 nitric oxide mediated signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0070509 calcium ion import Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005216 monoatomic ion channel activity Molecular Function

GO:0005221 intracellularly cyclic nucleotide-activated monoatomic cation channel activity Molecular Function

GO:0005222 intracellularly cAMP-activated cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G15990

ath:AT1G19780

ath:AT4G30560

ath:AT5G15410

ath:AT5G54250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.886

Rank 1 · LXL04_038740 · OH-1004

Cytoplasm0.075

Rank 2 · LXL04_038740 · OH-1004

Endoplasmic reticulum0.062

Rank 3 · LXL04_038740 · OH-1004

Nucleus0.034

Rank 4 · LXL04_038740 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_038740 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00027.36cNMP_binding554-639 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038740	`PF00027.36`	cNMP_binding	554	639	5.6e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65718`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 2	68.895%	Swiss-Prot	strong database homology
`Q94AS9`	Arabidopsis thaliana	Cyclic nucleotide-gated ion channel 4	47.544%	Swiss-Prot	moderate database homology
`Q9S9N5`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 7	37.153%	Swiss-Prot	moderate database homology
`Q9FXH6`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 8	36.979%	Swiss-Prot	moderate database homology
`Q9M0A4`	Arabidopsis thaliana	Putative cyclic nucleotide-gated ion channel 9	36.332%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card