LXL04_038722 | RubberDandelionOmics

Gene overview

LXL04_038722

Reference: OH-1004 Chr: Chr09 Coordinates: 48871121-48877028 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1899 bp · LXL04_038722|LXL04_038722|OH1004|cDNA

ATGGGTAAAGAAGGACCCTGCTGCCATTGTGGGATTGAACACACTCCATTATGGAGAAATGGGCCACCTGAAAAGCCCGTGTTATGTAATGCCTGTGGATCAAGGTGGAGAACTAGAGGCACATTAGCCGACTACATTCCTAAACATGCCATGAAAGACGTTCACGGCGGTCAAACTAATGACAACTCTGGTCAATCGGGCTCAACCAGCACAAGTGGTCCAAGTCAGCTGGTTTTCAGAAATGCTCCTCGAAGAAAAAG...

CDS

Download CDS FASTA

1899 bp · LXL04_038722|LXL04_038722|OH1004|CDS

ATGGGTAAAGAAGGACCCTGCTGCCATTGTGGGATTGAACACACTCCATTATGGAGAAATGGGCCACCTGAAAAGCCCGTGTTATGTAATGCCTGTGGATCAAGGTGGAGAACTAGAGGCACATTAGCCGACTACATTCCTAAACATGCCATGAAAGACGTTCACGGCGGTCAAACTAATGACAACTCTGGTCAATCGGGCTCAACCAGCACAAGTGGTCCAAGTCAGCTGGTTTTCAGAAATGCTCCTCGAAGAAAAAG...

Protein

Download Protein FASTA

632 aa · LXL04_038722|LXL04_038722|OH1004|PROTEIN

MGKEGPCCHCGIEHTPLWRNGPPEKPVLCNACGSRWRTRGTLADYIPKHAMKDVHGGQTNDNSGQSGSTSTSGPSQLVFRNAPRRKRSDLDQYVLTSVGRLSQQLLDFVQEQPEVYLDKPLDGDVLIDRADVAITNPLGTDLGALLLVAPVENINPISSDQAIEPSVETTTKCNVGENDVIDECSLIVEQQKKTSLSSQQILECFLPKRLKLPKKFIKTGVEISKFLIGAIENVGSSNVLQVVTDNAANCKAVGREIEKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038722`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038722

Location Chr09:48871121-48877028 (-)

Description Similar to GATA26: GATA transcription factor 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17570`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g47140`	Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g45170`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At5g66320`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`At3g51080`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038722 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G45170

ath:AT3G51080

ath:AT4G17570

ath:AT5G47140

ath:AT5G66320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · LXL04_038722 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_038722 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_038722 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_038722 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_038722 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00320.34GATA7-41 aa

PF04937.21DUF659217-298 aa

PF05699.20Dimer_Tnp_hAT535-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038722	`PF00320.34`	GATA	7	41	1.6e-10	41.1
LXL04_038722	`PF04937.21`	DUF659	217	298	5.6e-20	72.2
LXL04_038722	`PF05699.20`	Dimer_Tnp_hAT	535	603	9.1e-15	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4H1`	Arabidopsis thaliana	GATA transcription factor 26	70.968%	Swiss-Prot	weak database homology
`Q5PP38`	Arabidopsis thaliana	GATA transcription factor 27	62.121%	Swiss-Prot	weak database homology
`Q9M1U2`	Arabidopsis thaliana	GATA transcription factor 14	56.098%	Swiss-Prot	weak database homology
`Q9FH57`	Arabidopsis thaliana	GATA transcription factor 5	48.780%	Swiss-Prot	weak database homology
`Q9SD38`	Arabidopsis thaliana	GATA transcription factor 6	48.780%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card