LXL04_038677 | RubberDandelionOmics

Gene overview

LXL04_038677

Reference: OH-1004 Chr: Chr09 Coordinates: 47944048-47945841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1794 bp · LXL04_038677|LXL04_038677|OH1004|cDNA

atggtaTATAGCAACCCTAAAATGGATCTCAACAATAGTCTCGCACTCGTTTCTTGTAATGGCGACACAACATTAAGCTTAGACGGGTTTGGTTACGGCGGAAACACCGCTTCTGGATATGAAATCAGCCGTGAAAAACCGTCAAGTCCACTGGACGACGGCTGCAGATTAGTTCTCGGATTGGGGCCTACTCCGAGTATATATTCTAACGATTATTATTCCACCGGAACCGTAAGTAAAAAACCAACCCACGGATCAAA...

CDS

Download CDS FASTA

1794 bp · LXL04_038677|LXL04_038677|OH1004|CDS

ATGGTATATAGCAACCCTAAAATGGATCTCAACAATAGTCTCGCACTCGTTTCTTGTAATGGCGACACAACATTAAGCTTAGACGGGTTTGGTTACGGCGGAAACACCGCTTCTGGATATGAAATCAGCCGTGAAAAACCGTCAAGTCCACTGGACGACGGCTGCAGATTAGTTCTCGGATTGGGGCCTACTCCGAGTATATATTCTAACGATTATTATTCCACCGGAACCGTAAGTAAAAAACCAACCCACGGATCAAA...

Protein

Download Protein FASTA

597 aa · LXL04_038677|LXL04_038677|OH1004|PROTEIN

MVYSNPKMDLNNSLALVSCNGDTTLSLDGFGYGGNTASGYEISREKPSSPLDDGCRLVLGLGPTPSIYSNDYYSTGTVSKKPTHGSNTGLEYEGDSVLKLGFSDHSVTDLNPSCYSRKTSFDDEGSTSAKKSGGYMPSLLLAPRMHTTNVYEPGENSYHGPQLSSEPSAISDYSMGTISDHQTTTSKKCKFSGCTKGARGATSLCIGHGGGQRCQKPGCNKGAESRTAYCKAHGGGRRCQHLGCTKSAEGRTEYCIAHGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038677`
TK1151 ID	TkA04G454730
OH-1004 ID	LXL04_038677
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038677

Location Chr09:47944048-47945841 (+)

Description Similar to WRKY19: Probable WRKY transcription factor 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12020`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038677 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:1902065 response to L-glutamate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G12020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_038677 · OH-1004

Cytoplasm0.119

Rank 2 · LXL04_038677 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_038677 · OH-1004

Mitochondrion0.017

Rank 4 · LXL04_038677 · OH-1004

Plastid0.009

Rank 5 · LXL04_038677 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24906.2Zf_WRKY19187-210 aa

PF24906.2Zf_WRKY19211-235 aa

PF24906.2Zf_WRKY19236-260 aa

PF24906.2Zf_WRKY19261-286 aa

PF24906.2Zf_WRKY19287-311 aa

PF24906.2Zf_WRKY19312-336 aa

PF24906.2Zf_WRKY19337-361 aa

PF24906.2Zf_WRKY19390-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038677	`PF24906.2`	Zf_WRKY19	187	210	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	211	235	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	236	260	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	261	286	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	287	311	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	312	336	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	337	361	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	390	414	1.7e-72	239.5
LXL04_038677	`PF24906.2`	Zf_WRKY19	415	439	1.7e-72	239.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ67`	Arabidopsis thaliana	Probable WRKY transcription factor 19	56.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card