LXL04_038513 | RubberDandelionOmics

Gene overview

LXL04_038513

Reference: OH-1004 Chr: Chr09 Coordinates: 42811367-42820070 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1539 bp · LXL04_038513|LXL04_038513|OH1004|cDNA

ATGCCCATTTCTCCTTCCATATTTAACTTACAGAATAAAAATTTACCTCTTCACCAAAAAATACACACAGCAAAGGTGATAATAATTTTCATAATACCAATGGAGttcctcttcctcctcctctTGACTTCCTCCACCACCCTCATGGCCTACTCTCAGACCATCGTCGAAACCTTACCGGGATACCCTGGTCCTCTCCCTTTCAAACTCGAAACAGGgtacATAGGTGTAGGGGAAGATGAAGCTGTGCAGCTTTTTTA...

CDS

Download CDS FASTA

1539 bp · LXL04_038513|LXL04_038513|OH1004|CDS

ATGCCCATTTCTCCTTCCATATTTAACTTACAGAATAAAAATTTACCTCTTCACCAAAAAATACACACAGCAAAGGTGATAATAATTTTCATAATACCAATGGAGTTCCTCTTCCTCCTCCTCTTGACTTCCTCCACCACCCTCATGGCCTACTCTCAGACCATCGTCGAAACCTTACCGGGATACCCTGGTCCTCTCCCTTTCAAACTCGAAACAGGGTACATAGGTGTAGGGGAAGATGAAGCTGTGCAGCTTTTTTA...

Protein

Download Protein FASTA

512 aa · LXL04_038513|LXL04_038513|OH1004|PROTEIN

MPISPSIFNLQNKNLPLHQKIHTAKVIIIFIIPMEFLFLLLLTSSTTLMAYSQTIVETLPGYPGPLPFKLETGYIGVGEDEAVQLFYYFVESEGNPEEDPLIVWLAGGPGCGTLRAFFFEIGPMQIKYGNYMDNVPALKLDPNSWTKVANVIYLDAPTLTGYSYTKTPEVVRSSDTTSASQTAEFLRKFVRTHPKFLKNPMYVTGISYSGIVIPIITEELYKGNDEGLEPIVNIQGYMGGNPLTNKTGDINSRLEYAYRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038513`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038513

Location Chr09:42811367-42820070 (-)

Description Similar to SCPL18: Serine carboxypeptidase-like 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33540`	Probable carboxypeptidase.	No verified direct reference in this release
`At2g22980`	Catalyzes the formation of 1,2-bis-O-sinapoyl beta-D-glucoside.	Related Arabidopsis serine carboxypeptidase-like sinapoylglucose acyltransferases display distinct but overlapping substrate specificities.2007 · DOI: 10.1104/pp.107.098970
`At1g73280`	Probable carboxypeptidase.	No verified direct reference in this release
`At3g10450`	Probable carboxypeptidase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038513 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0019748 secondary metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0004185 serine-type carboxypeptidase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

GO:0016752 sinapoyltransferase activity Molecular Function

GO:0047158 sinapoylglucose-sinapoylglucose O-sinapoyltransferase activity Molecular Function

KEGG gene cross-reference

ag:QGI57842

ath:AT1G33540

ath:AT1G73280

ath:AT2G22980

ath:AT3G10450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.439

Rank 1 · LXL04_038513 · OH-1004

Extracellular0.210

Rank 2 · LXL04_038513 · OH-1004

Endoplasmic reticulum0.131

Rank 3 · LXL04_038513 · OH-1004

Cytoplasm0.102

Rank 4 · LXL04_038513 · OH-1004

Cell membrane0.088

Rank 5 · LXL04_038513 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00450.29Peptidase_S1060-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038513	`PF00450.29`	Peptidase_S10	60	508	7.8e-113	378.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7Z9`	Arabidopsis thaliana	Serine carboxypeptidase-like 18	46.121%	Swiss-Prot	moderate database homology
`Q8H780`	Arabidopsis thaliana	Serine carboxypeptidase-like 13	42.765%	Swiss-Prot	moderate database homology
`Q9CAU1`	Arabidopsis thaliana	Serine carboxypeptidase-like 3	43.737%	Swiss-Prot	moderate database homology
`Q9SQX6`	Arabidopsis thaliana	Serine carboxypeptidase-like 7	43.167%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card