LXL04_038390 | RubberDandelionOmics

Gene overview

LXL04_038390

Reference: OH-1004 Chr: Chr09 Coordinates: 39559359-39564033 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · LXL04_038390|LXL04_038390|OH1004|cDNA

ATGAGCCGAAGCAGCTCGCTAAAAGCTCGGCTCGAGACCGATTATAAACGAATCTCGTTCCACTCCTGCTTCCATCGCCGACTCCGACACACACAAACCCATCGCCGCCGACCACTGAGCCATCGCGGCATCGCCCATCGCCGACTCCGAGCTACTCCCGCCTGCGCCGGCTGTCCAGCGCCTCCGTCATCCACCTCCGACTTCACTCAGGTTTTCGCCATGAGCAGATCAGGTCAACCTCCAGATCTTAAAAAGTACAT...

CDS

Download CDS FASTA

462 bp · LXL04_038390|LXL04_038390|OH1004|CDS

ATGAGCCGAAGCAGCTCGCTAAAAGCTCGGCTCGAGACCGATTATAAACGAATCTCGTTCCACTCCTGCTTCCATCGCCGACTCCGACACACACAAACCCATCGCCGCCGACCACTGAGCCATCGCGGCATCGCCCATCGCCGACTCCGAGCTACTCCCGCCTGCGCCGGCTGTCCAGCGCCTCCGTCATCCACCTCCGACTTCACTCAGGTTTTCGCCATGAGCAGATCAGGTCAACCTCCAGATCTTAAAAAGTACAT...

Protein

Download Protein FASTA

153 aa · LXL04_038390|LXL04_038390|OH1004|PROTEIN

MSRSSSLKARLETDYKRISFHSCFHRRLRHTQTHRRRPLSHRGIAHRRLRATPACAGCPAPPSSTSDFTQVFAMSRSGQPPDLKKYMDKQLQIKLNANRTVVGTLRGFDQFMNLVIDNTVEVNGDEKNDIGMVVIRGNSVVTVEALEPVSRGQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038390`
TK1151 ID	TkA04G424460
OH-1004 ID	LXL04_038390
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.732 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038390

Location Chr09:39559359-39564033 (-)

Description Similar to At2g23930: Probable small nuclear ribonucleoprotein G

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23930`	Probable common Sm protein, is found in U1 and U2 snRNPs and may be part of the spliceosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038390 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process

GO:0000245 spliceosomal complex assembly Biological Process

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0008380 RNA splicing Biological Process

GO:0036261 7-methylguanosine cap hypermethylation Biological Process

GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process

GO:0071045 nuclear histone mRNA catabolic process Biological Process

GO:1903241 U2-type prespliceosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G23930

dme:Dmel_CG9742

hsa:6637

mmu:68011

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.724

Rank 1 · LXL04_038390 · OH-1004

Cytoplasm0.345

Rank 2 · LXL04_038390 · OH-1004

Endoplasmic reticulum0.043

Rank 3 · LXL04_038390 · OH-1004

Cell membrane0.040

Rank 4 · LXL04_038390 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_038390 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01423.29LSM82-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038390	`PF01423.29`	LSM	82	144	3.5e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82221`	Arabidopsis thaliana	Probable small nuclear ribonucleoprotein G	88.462%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card