LXL04_038360 | RubberDandelionOmics

Gene overview

LXL04_038360

Reference: OH-1004 Chr: Chr09 Coordinates: 38555731-38557258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · LXL04_038360|LXL04_038360|OH1004|cDNA

ATGGGAAGCTTAAATCCATATCCTGAGCTAAGTTTCGATTTCCGACCATGTTTTATCCCCAAAACAATCGGCCAGTTTCTTGGAGAAGTGTCGAGGATCAATAACGTAACCGCTAAGGTTTCGCAAGTTGATGATTTTGTTAACCACTTGGAAATCGAAACGCGGAAAATTGAAGCAGTCAAAGGAGAATTCCCTCTTTGCATGCTTCTTATCAACGATGCAATCGATGTGTTGAAGAACGAATCAATGAAGTTGAAGAA...

CDS

Download CDS FASTA

933 bp · LXL04_038360|LXL04_038360|OH1004|CDS

ATGGGAAGCTTAAATCCATATCCTGAGCTAAGTTTCGATTTCCGACCATGTTTTATCCCCAAAACAATCGGCCAGTTTCTTGGAGAAGTGTCGAGGATCAATAACGTAACCGCTAAGGTTTCGCAAGTTGATGATTTTGTTAACCACTTGGAAATCGAAACGCGGAAAATTGAAGCAGTCAAAGGAGAATTCCCTCTTTGCATGCTTCTTATCAACGATGCAATCGATGTGTTGAAGAACGAATCAATGAAGTTGAAGAA...

Protein

Download Protein FASTA

310 aa · LXL04_038360|LXL04_038360|OH1004|PROTEIN

MGSLNPYPELSFDFRPCFIPKTIGQFLGEVSRINNVTAKVSQVDDFVNHLEIETRKIEAVKGEFPLCMLLINDAIDVLKNESMKLKKTSNPEPVLEEFIPMKNNCNDDSKVEITASQKDAGDKRNWLSSTHLWNANENADQKAISVKENSSERTEEEDAVKLCLITEINGVNGGLGCRPPPQKQTTTRKQRRCWSTELHRRFLSALQDLGGSQAATPKQIRDLMQVDGLTNDEVKSHLQKYRIHTRRHPSSNTNQIMGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038360`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038360

Location Chr09:38555731-38557258 (+)

Description Similar to HHO5: Transcription factor HHO5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37180`	Transcriptional repressor that functions with ULT1 in a pathway which regulates floral meristem homeostasis and organ number in the flower.	No verified direct reference in this release
`At2g03500`	Transcription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature.	No verified direct reference in this release
`At1g13300`	Transcription factor involved in nitrate and phosphate signaling in roots.	Overexpressing HRS1 confers hypersensitivity to low phosphate-elicited inhibition of primary root growth in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1744-7909.2009.00819.x HRS1 acts as a negative regulator of abscisic acid signaling to promote timely germination of Arabidopsis seeds.2012 · DOI: 10.1371/journal.pone.0035764 AtNIGT1/HRS1 integrates nitrate and phosphate signals at the Arabidopsis root tip.2015 · DOI: 10.1038/ncomms7274
`At1g49560`	Probable transcription factor involved in phosphate signaling in roots.	No verified direct reference in this release
`At1g25550`	Probable transcription factor involved in phosphate signaling in roots.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038360 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032107 regulation of response to nutrient levels Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0048449 floral organ formation Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT1G13300

ath:AT1G25550

ath:AT1G49560

ath:AT2G03500

ath:AT4G37180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_038360 · OH-1004

Cytoplasm0.089

Rank 2 · LXL04_038360 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_038360 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_038360 · OH-1004

Plastid0.011

Rank 5 · LXL04_038360 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26575.1HHO5_N13-83 aa

PF00249.38Myb_DNA-binding191-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038360	`PF26575.1`	HHO5_N	13	83	1.2e-23	83.6
LXL04_038360	`PF00249.38`	Myb_DNA-binding	191	242	2.7e-06	28.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JRB0`	Arabidopsis thaliana	Transcription factor HHO5	36.278%	Swiss-Prot	moderate database homology
`Q9ZQ85`	Arabidopsis thaliana	Myb family transcription factor EFM	34.954%	Swiss-Prot	moderate database homology
`Q9FX67`	Arabidopsis thaliana	Transcription factor HRS1	37.405%	Swiss-Prot	moderate database homology
`Q9FX84`	Arabidopsis thaliana	Transcription factor HHO6	36.061%	Swiss-Prot	moderate database homology
`Q9FPE8`	Arabidopsis thaliana	Transcription factor HHO3	37.024%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card