LXL04_038304 | RubberDandelionOmics

Gene overview

LXL04_038304

Reference: OH-1004 Chr: Chr09 Coordinates: 36915774-36916379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · LXL04_038304|LXL04_038304|OH1004|cDNA

ATGCCGCGCAAGGCGCGGTTTTTCGACTCGTTAGATATAATTATGGTGGTTGGTGGGTGGAATTCAAGCAACACTTCACACCTACAAGAGATTGCAGAGGATCGTGGCATTCCGTCTTATTGGGTCGATAGTGAAGCTAGAGTAGGTCCCGGAAACCACATAACTTACAAATTAATGCATGGTGAGTTGGTTGAGAAGAAAAATTGGCTACCAAAAGGGCATGTAACAATTGGTGTCACATCTGGTGCATGCGCATCTAC...

CDS

Download CDS FASTA

339 bp · LXL04_038304|LXL04_038304|OH1004|CDS

ATGCCGCGCAAGGCGCGGTTTTTCGACTCGTTAGATATAATTATGGTGGTTGGTGGGTGGAATTCAAGCAACACTTCACACCTACAAGAGATTGCAGAGGATCGTGGCATTCCGTCTTATTGGGTCGATAGTGAAGCTAGAGTAGGTCCCGGAAACCACATAACTTACAAATTAATGCATGGTGAGTTGGTTGAGAAGAAAAATTGGCTACCAAAAGGGCATGTAACAATTGGTGTCACATCTGGTGCATGCGCATCTAC...

Protein

Download Protein FASTA

112 aa · LXL04_038304|LXL04_038304|OH1004|PROTEIN

MPRKARFFDSLDIIMVVGGWNSSNTSHLQEIAEDRGIPSYWVDSEARVGPGNHITYKLMHGELVEKKNWLPKGHVTIGVTSGACASTPDKVVEDVLMRIFEIKGEESLHDMN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038304`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038304

Location Chr09:36915774-36916379 (-)

Description Similar to ISPH: 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34350`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4- diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).	Characterization of the Arabidopsis clb6 mutant illustrates the importance of posttranscriptional regulation of the methyl-D-erythritol 4-phosphate pathway.2005 · DOI: 10.1105/tpc.104.028860 The Arabidopsis IspH homolog is involved in the plastid nonmevalonate pathway of isoprenoid biosynthesis.2005 · DOI: 10.1104/pp.104.058735

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0731900`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038304 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016114 terpenoid biosynthetic process Biological Process

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0050992 dimethylallyl diphosphate biosynthetic process Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0046429 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity (ferredoxin) Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

GO:0051745 4-hydroxy-3-methylbut-2-enyl diphosphate reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G34350

dosa:Os03g0731900

syc:syc1431_d

syf:Synpcc7942_0073

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.683

Rank 1 · LXL04_038304 · OH-1004

Nucleus0.278

Rank 2 · LXL04_038304 · OH-1004

Extracellular0.096

Rank 3 · LXL04_038304 · OH-1004

Mitochondrion0.061

Rank 4 · LXL04_038304 · OH-1004

Peroxisome0.050

Rank 5 · LXL04_038304 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02401.24LYTB10-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038304	`PF02401.24`	LYTB	10	99	2e-16	60.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94B35`	Arabidopsis thaliana	4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic	71.287%	Swiss-Prot	strong database homology
`Q6AVG6`	Oryza sativa subsp. japonica	4-hydroxy-3-methylbut-2-enyl diphosphate reductase, chloroplastic	72.277%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card