LXL04_038273 | RubberDandelionOmics

Gene overview

LXL04_038273

Reference: OH-1004 Chr: Chr09 Coordinates: 36209390-36210214 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · LXL04_038273|LXL04_038273|OH1004|cDNA

ATGAATCTTCTTCCTCCTTCCACACTCTGTTCCACGTCTGCTCATTCCTCAAACCGCCCTCCGCCACCGCCTCCTCCCCACCGCCACCTCCACTTCCGCACATCTCTCCGGCAAAACCTCCGCTACCTCAAATCCCTCGGAATCACCCAACCAACAGCCGCATCCCCCGAAACCCTATCTCACATACTCTCAACCATAGACTACTTCAAATCCAAGGGATTTTCAGAACCCGATTTCCCACGAATCTCCTTTCTCTCCCC...

CDS

Download CDS FASTA

825 bp · LXL04_038273|LXL04_038273|OH1004|CDS

ATGAATCTTCTTCCTCCTTCCACACTCTGTTCCACGTCTGCTCATTCCTCAAACCGCCCTCCGCCACCGCCTCCTCCCCACCGCCACCTCCACTTCCGCACATCTCTCCGGCAAAACCTCCGCTACCTCAAATCCCTCGGAATCACCCAACCAACAGCCGCATCCCCCGAAACCCTATCTCACATACTCTCAACCATAGACTACTTCAAATCCAAGGGATTTTCAGAACCCGATTTCCCACGAATCTCCTTTCTCTCCCC...

Protein

Download Protein FASTA

274 aa · LXL04_038273|LXL04_038273|OH1004|PROTEIN

MNLLPPSTLCSTSAHSSNRPPPPPPPHRHLHFRTSLRQNLRYLKSLGITQPTAASPETLSHILSTIDYFKSKGFSEPDFPRISFLSPHLFTPSFNPTTIDPVFEFLTVDLAASPEESIGLILKCPHILESNPEFCLKPTLEYLKRLGIKQLNSPTTLNAHLLDTRVAKLEEKMRFLRGVGFSDEECRRVCGRFPAIFGYGIEHNLRPKFEYLVREMKRNGREEVNKFPQYFGFSLENRIKPRHLHLKRRNVVDGEVRLNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038273`
TK1151 ID	TkA04G413040
OH-1004 ID	LXL04_038273
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038273

Location Chr09:36209390-36210214 (+)

Description Similar to MTERF1: Transcription termination factor MTEF1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03050`	Transcription termination factor required for plastid- specific rRNA accumulation and protein synthesis in plastids.	A mutation in the Arabidopsis mTERF-related plastid protein SOLDAT10 activates retrograde signaling and suppresses (1)O(2)-induced cell death.2009 · DOI: 10.1111/j.1365-313x.2009.03965.x
`At2g36000`	Transcription termination factor required for chloroplast gene expression and protein synthesis in chloroplasts.	Arabidopsis Seedling Lethal 1 Interacting With Plastid-Encoded RNA Polymerase Complex Proteins Is Essential for Chloroplast Development.2020 · DOI: 10.3389/fpls.2020.602782
`At4g14605`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	Arabidopsis MDA1, a nuclear-encoded protein, functions in chloroplast development and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0042924 mTERF5 Acts as a Transcriptional Pausing Factor to Positively Regulate Transcription of Chloroplast psbEFLJ.2019 · DOI: 10.1016/j.molp.2019.05.007
`At5g55580`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	Mutations in the plant-conserved MTERF9 alter chloroplast gene expression, development and tolerance to abiotic stress in Arabidopsis thaliana.2015 · DOI: 10.1111/ppl.12307
`At2g21710`	Transcription termination factor involved in processing of plastid transcripts (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038273 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010343 singlet oxygen-mediated programmed cell death Biological Process

GO:0032502 developmental process Biological Process

GO:0042793 plastid transcription Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

KEGG gene cross-reference

ath:AT2G03050

ath:AT2G36000

ath:AT4G14605

ath:AT5G55580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.606

Rank 1 · LXL04_038273 · OH-1004

Plastid0.237

Rank 2 · LXL04_038273 · OH-1004

Nucleus0.062

Rank 3 · LXL04_038273 · OH-1004

Cytoplasm0.053

Rank 4 · LXL04_038273 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_038273 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536.20mTERF35-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038273	`PF02536.20`	mTERF	35	269	2.2e-35	122.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84X53`	Arabidopsis thaliana	Transcription termination factor MTEF1, chloroplastic	34.711%	Swiss-Prot	moderate database homology
`Q9SJ50`	Arabidopsis thaliana	Protein SEEDLING LETHAL 1, chloroplastic	35.945%	Swiss-Prot	moderate database homology
`F4JVI3`	Arabidopsis thaliana	Transcription termination factor MTERF5, chloroplastic	27.604%	Swiss-Prot	weak database homology
`Q9FM80`	Arabidopsis thaliana	Transcription termination factor MTERF9, chloroplastic	25.100%	Swiss-Prot	weak database homology
`F4IHL3`	Arabidopsis thaliana	Transcription termination factor MTERF2, chloroplastic	29.717%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card