LXL04_038256 | RubberDandelionOmics

Gene overview

LXL04_038256

Reference: OH-1004 Chr: Chr09 Coordinates: 35472314-35473525 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_038256|LXL04_038256|OH1004|cDNA

ATGCCAAAAGGGTTATCTACTGTTTTCACTTTCCTTCCGTTGGTCATCATTTTTTCCATTTCAGAAACTACGACCGTGAAGGGGAAAGTATGTGAAAAGCCTAGCAAGACCTGGTTTGGGACCTGCAAAGACACAGTCAAGTGCGACAAACAGTGCATAGAGTGGGAAGGTGCAGAACATGGAGCTTGTCACCAACGTGAAGCGAAATACATGTGCTTTTGCTACAACAAATGTGGTGCGAAGGAGTCACCTAGTCCTCC...

CDS

Download CDS FASTA

444 bp · LXL04_038256|LXL04_038256|OH1004|CDS

ATGCCAAAAGGGTTATCTACTGTTTTCACTTTCCTTCCGTTGGTCATCATTTTTTCCATTTCAGAAACTACGACCGTGAAGGGGAAAGTATGTGAAAAGCCTAGCAAGACCTGGTTTGGGACCTGCAAAGACACAGTCAAGTGCGACAAACAGTGCATAGAGTGGGAAGGTGCAGAACATGGAGCTTGTCACCAACGTGAAGCGAAATACATGTGCTTTTGCTACAACAAATGTGGTGCGAAGGAGTCACCTAGTCCTCC...

Protein

Download Protein FASTA

147 aa · LXL04_038256|LXL04_038256|OH1004|PROTEIN

MPKGLSTVFTFLPLVIIFSISETTTVKGKVCEKPSKTWFGTCKDTVKCDKQCIEWEGAEHGACHQREAKYMCFCYNKCGAKESPSPPSTAPPGNGAPTPNPPGPPGGEGRSPPPTEGQPPPAEGGQPPLAKGGQPPPSSCISPGFLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038256`
TK1151 ID	TkA04G409860
OH-1004 ID	LXL04_038256
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038256

Location Chr09:35472314-35473525 (+)

Description Similar to Anther-specific protein SF18 (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19610`	Confers broad-spectrum resistance to pathogens.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038256 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0140677 molecular function activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G19610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.758

Rank 1 · LXL04_038256 · OH-1004

Cell membrane0.119

Rank 2 · LXL04_038256 · OH-1004

Endoplasmic reticulum0.094

Rank 3 · LXL04_038256 · OH-1004

Cytoplasm0.077

Rank 4 · LXL04_038256 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_038256 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00304.27Gamma-thionin29-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038256	`PF00304.27`	Gamma-thionin	29	78	7.2e-09	36.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82787`	Arabidopsis thaliana	Defensin-like protein 19	45.205%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card