LXL04_038178 | RubberDandelionOmics

Gene overview

LXL04_038178

Reference: OH-1004 Chr: Chr09 Coordinates: 33050674-33051237 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · LXL04_038178|LXL04_038178|OH1004|cDNA

ATGGCAACCCCGATCAGAAAATTTACCAAACTATCCTTCGTCATCATCTTGCTCATATCCTTTCTTACGTTTTTGAAAGGCGATGAACTAGGCGAGCTCAAACGGTCCTCCATGACTCTTTACTTTCAAGACTATTTTGGTGGACCAAATGCCACCATGAAACCGGTCACCTTCTCTGCTGACGCATGGTCCTTCAAACAATTTGGGACCATATTTTGTACGGATGACCCAATAACTGTAACCATGGATCAGGGTTCAGC...

CDS

Download CDS FASTA

564 bp · LXL04_038178|LXL04_038178|OH1004|CDS

ATGGCAACCCCGATCAGAAAATTTACCAAACTATCCTTCGTCATCATCTTGCTCATATCCTTTCTTACGTTTTTGAAAGGCGATGAACTAGGCGAGCTCAAACGGTCCTCCATGACTCTTTACTTTCAAGACTATTTTGGTGGACCAAATGCCACCATGAAACCGGTCACCTTCTCTGCTGACGCATGGTCCTTCAAACAATTTGGGACCATATTTTGTACGGATGACCCAATAACTGTAACCATGGATCAGGGTTCAGC...

Protein

Download Protein FASTA

187 aa · LXL04_038178|LXL04_038178|OH1004|PROTEIN

MATPIRKFTKLSFVIILLISFLTFLKGDELGELKRSSMTLYFQDYFGGPNATMKPVTFSADAWSFKQFGTIFCTDDPITVTMDQGSAEIGRAQGIYVTSALDGSNSHVLISLVFTNKEFGGSTLEVQGASKQFERVREVAVVGGTGKFRLARGYATFETVHLDLSLSYSIIEGNFTVWHYKNDRNTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038178`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038178

Location Chr09:33050674-33051237 (-)

Description Similar to DIR1: Dirigent protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42510`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At5g42500`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release
`At2g21110`	Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038178 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0048046 apoplast Cellular Component

GO:0140859 pterocarpan synthase activity Molecular Function

KEGG gene cross-reference

ath:AT2G21110

ath:AT5G42500

ath:AT5G42510

gmx:100500621

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.317

Rank 1 · LXL04_038178 · OH-1004

Extracellular0.316

Rank 2 · LXL04_038178 · OH-1004

Endoplasmic reticulum0.232

Rank 3 · LXL04_038178 · OH-1004

Cytoplasm0.139

Rank 4 · LXL04_038178 · OH-1004

Cell membrane0.066

Rank 5 · LXL04_038178 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03018.20Dirigent37-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038178	`PF03018.20`	Dirigent	37	177	1e-40	139.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIG6`	Arabidopsis thaliana	Dirigent protein 1	38.000%	Swiss-Prot	moderate database homology
`Q9FIG7`	Arabidopsis thaliana	Dirigent protein 2	38.000%	Swiss-Prot	moderate database homology
`Q9SKQ2`	Arabidopsis thaliana	Dirigent protein 4	34.444%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card