LXL04_038143 | RubberDandelionOmics

Gene overview

LXL04_038143

Reference: OH-1004 Chr: Chr09 Coordinates: 32184588-32186577 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

786 bp · LXL04_038143|LXL04_038143|OH1004|cDNA

ATGTTTATCTCTCGCAGATCTTGGACGAAAACTTCAAACTTCAAACGGAGATTTCGATTTCGCTTTCGGTTCAATCCAGCAGTTATTGCAAGACTTCTTAAAAGCTCACAAAAACACACAGAGTACACCGGCAATCGACTTCATTTCCACTTTTTTGGGGATTATGCAGTTCTTAGAAGAATACGAACACATACGGCGATTACACAGTTTATACATGCAAAAGAAACGGAATCAGTAAATGGTTTTTATGACTATTCACT...

CDS

Download CDS FASTA

786 bp · LXL04_038143|LXL04_038143|OH1004|CDS

ATGTTTATCTCTCGCAGATCTTGGACGAAAACTTCAAACTTCAAACGGAGATTTCGATTTCGCTTTCGGTTCAATCCAGCAGTTATTGCAAGACTTCTTAAAAGCTCACAAAAACACACAGAGTACACCGGCAATCGACTTCATTTCCACTTTTTTGGGGATTATGCAGTTCTTAGAAGAATACGAACACATACGGCGATTACACAGTTTATACATGCAAAAGAAACGGAATCAGTAAATGGTTTTTATGACTATTCACT...

Protein

Download Protein FASTA

261 aa · LXL04_038143|LXL04_038143|OH1004|PROTEIN

MFISRRSWTKTSNFKRRFRFRFRFNPAVIARLLKSSQKHTEYTGNRLHFHFFGDYAVLRRIRTHTAITQFIHAKETESVNGFYDYSLIKNLQDIHQELEFSGDDEVKFSNHGRELVAGSSDDSIYVYDVEANKLSLLIQAHTSDVNNVCFVDEASHLIYSGSDDNVCKVWDRRCFRSKGKPAGILMGHLKGITFLDTRGDGRYLISNGKDQTIKLWDIRKMSSNATRWMDYPLRARDVKHPSDQSVAMYKGHSVLRTLIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038143`
TK1151 ID	TkA03G583660
OH-1004 ID	LXL04_038143
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 94.702 / OH-1004 55.172 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_038143`
Location	Chr09:32184588-32186577 (+)
Description	Similar to LEC14B protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038143` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0080135 regulation of cellular response to stress Biological Process GO:1902412 regulation of mitotic cytokinesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	bta:539433 hsa:80344 pon:100173316 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.424

Rank 1 · LXL04_038143 · OH-1004

Cytoplasm0.332

Rank 2 · LXL04_038143 · OH-1004

Mitochondrion0.110

Rank 3 · LXL04_038143 · OH-1004

Endoplasmic reticulum0.068

Rank 4 · LXL04_038143 · OH-1004

Cell membrane0.063

Rank 5 · LXL04_038143 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24796.2WDR5582-173 aa

PF24805.2EIF3I104-173 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd104-171 aa

PF25175.2Beta-prop_WDR5105-221 aa

PF25174.2Beta-prop_THOC3105-231 aa

PF24817.2WD40_WDHD1_1st105-171 aa

PF24807.2WD40_CDC20-Fz105-224 aa

PF25173.2Beta-prop_WDR3_1st106-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038143	`PF24796.2`	WDR55	82	173	1.8e-17	64.1
LXL04_038143	`PF24805.2`	EIF3I	104	173	5.4e-09	36.3
LXL04_038143	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	104	171	5.7e-09	36.4
LXL04_038143	`PF25175.2`	Beta-prop_WDR5	105	221	4.5e-20	72.8
LXL04_038143	`PF25174.2`	Beta-prop_THOC3	105	231	2.5e-19	70.1
LXL04_038143	`PF24817.2`	WD40_WDHD1_1st	105	171	6.7e-17	62.3
LXL04_038143	`PF24807.2`	WD40_CDC20-Fz	105	224	6.9e-16	59.1
LXL04_038143	`PF25173.2`	Beta-prop_WDR3_1st	106	171	3.7e-29	102.4
LXL04_038143	`PF25173.2`	Beta-prop_WDR3_1st	106	221	3.7e-29	102.4
LXL04_038143	`PF23381.2`	Beta-prop_IFT122_1st	106	173	1.1e-14	55.1
LXL04_038143	`PF25391.2`	WD40_Gbeta	106	174	5.6e-11	42.7
LXL04_038143	`PF24105.2`	Beta-prop_CAF1B_HIR1	106	173	2.1e-07	31.0
LXL04_038143	`PF25172.2`	Beta-prop_WDR3_2nd	107	217	1.8e-12	47.8
LXL04_038143	`PF23409.2`	Beta-prop_EML	107	173	2.6e-07	31.1
LXL04_038143	`PF24817.2`	WD40_WDHD1_1st	110	223	6.7e-17	62.3
LXL04_038143	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	110	170	2.3e-07	31.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card