LXL04_038141 | RubberDandelionOmics

Gene overview

LXL04_038141

Reference: OH-1004 Chr: Chr09 Coordinates: 32152356-32155084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1611 bp · LXL04_038141|LXL04_038141|OH1004|cDNA

ATGCTTGCGGAAATGGAGCCGATTGTACTCCAATCATTCAAGGCGGTGCTTGTTTTAGCCCCAATACCGTCAAAGATCACTCCCCACCTGGCAAGTCTTCCAGAGTTCCAGTGCTTGGCTGGATTTAACTTCCAGTGCAAAACGCCCAAATCTGCACACCCAGAACCAAAATCCTGCATATTCGAGCATATCTACTTCTCCTTACCGAACTCAATCGGTTTCGGTATGTCTGTATACGAATCCAGACGAAAGTTCGGTGA...

CDS

Download CDS FASTA

1611 bp · LXL04_038141|LXL04_038141|OH1004|CDS

ATGCTTGCGGAAATGGAGCCGATTGTACTCCAATCATTCAAGGCGGTGCTTGTTTTAGCCCCAATACCGTCAAAGATCACTCCCCACCTGGCAAGTCTTCCAGAGTTCCAGTGCTTGGCTGGATTTAACTTCCAGTGCAAAACGCCCAAATCTGCACACCCAGAACCAAAATCCTGCATATTCGAGCATATCTACTTCTCCTTACCGAACTCAATCGGTTTCGGTATGTCTGTATACGAATCCAGACGAAAGTTCGGTGA...

Protein

Download Protein FASTA

536 aa · LXL04_038141|LXL04_038141|OH1004|PROTEIN

MLAEMEPIVLQSFKAVLVLAPIPSKITPHLASLPEFQCLAGFNFQCKTPKSAHPEPKSCIFEHIYFSLPNSIGFGMSVYESRRKFGEILATEAPVDCDVVIAVPDSGVVAALGYAAKAGVPFQQGLIRSHYVGQTFIEPSQRIRDFGVKPKLSPFRLDMYRCTNPYMITDKIIKVTLHMYINVSNDHFCFVNVGMGKMRSMNRKKKHDDAMSKNPIKTCDNNSGTTRPWSDLTHDVLNLVMMKLGVVDFYAFIRVCKSWR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038141`
TK1151 ID	TkA05G175790
OH-1004 ID	LXL04_038141
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 93.976 / OH-1004 29.104 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038141

Location Chr09:32152356-32155084 (-)

Description Similar to ASE2: Amidophosphoribosyltransferase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34740`	Catalyzes the first committed step of 'de novo purine biosynthesis from glutamine.	Molecular analysis of "de novo" purine biosynthesis in solanaceous species and in Arabidopsis thaliana.2004 · DOI: 10.2741/1344 Characterization of Arabidopsis glutamine phosphoribosyl pyrophosphate amidotransferase-deficient mutants.2004 · DOI: 10.1104/pp.104.040956 Chemical genetic identification of glutamine phosphoribosylpyrophosphate amidotransferase as the target for a novel bleaching herbicide in Arabidopsis.2007 · DOI: 10.1104/pp.107.099705
`At2g16570`	Catalyzes the first committed step of 'de novo' purine biosynthesis from glutamine.	Characterization of Arabidopsis glutamine phosphoribosyl pyrophosphate amidotransferase-deficient mutants.2004 · DOI: 10.1104/pp.104.040956
`At4g38880`	Catalyzes the first committed step of 'de novo' purine biosynthesis from glutamine.	Chemical genetic identification of glutamine phosphoribosylpyrophosphate amidotransferase as the target for a novel bleaching herbicide in Arabidopsis.2007 · DOI: 10.1104/pp.107.099705

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038141 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006164 purine nucleotide biosynthetic process Biological Process

GO:0006189 'de novo' IMP biosynthetic process Biological Process

GO:0009113 purine nucleobase biosynthetic process Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004044 amidophosphoribosyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G16570

ath:AT4G34740

ath:AT4G38880

gmx:548065

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.434

Rank 1 · LXL04_038141 · OH-1004

Cytoplasm0.385

Rank 2 · LXL04_038141 · OH-1004

Cell membrane0.157

Rank 3 · LXL04_038141 · OH-1004

Endoplasmic reticulum0.106

Rank 4 · LXL04_038141 · OH-1004

Plastid0.053

Rank 5 · LXL04_038141 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box229-270 aa

PF03478.25Beta-prop_KIB1-4293-483 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038141	`PF00646.39`	F-box	229	270	1.5e-06	28.5
LXL04_038141	`PF03478.25`	Beta-prop_KIB1-4	293	483	2.2e-18	67.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STG9`	Arabidopsis thaliana	Amidophosphoribosyltransferase 2, chloroplastic	73.529%	Swiss-Prot	weak database homology
`Q9SI61`	Arabidopsis thaliana	Amidophosphoribosyltransferase 1, chloroplastic	72.059%	Swiss-Prot	weak database homology
`Q9T0J5`	Arabidopsis thaliana	Amidophosphoribosyltransferase 3, chloroplastic	66.154%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card