LXL04_038080 | RubberDandelionOmics

Gene overview

LXL04_038080

Reference: OH-1004 Chr: Chr09 Coordinates: 30997028-30999932 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1898 bp · LXL04_038080|LXL04_038080|OH1004|cDNA

ATGGATGTACTCTTCAATTCAATCGATGTCCGGGATTTGTTATCATCACACGATCTAGACGACTCTTCGCCGCTCTCCGCCCCCGATCTCCGCCTCCTCATCGACCGTCTCCAAGTCCGTTCACTCGACATTAAGTCCAAAGTCCACAATTACATACTCGCTCACAATGATGACTTCTCTGCCCTATTCTCTCGCTGCTCCGATGCTGTCGTTAATTCCGAGCAGCTATCCGATCAAGTGTCTAACCTTGTCGATCTGTT...

CDS

Download CDS FASTA

1743 bp · LXL04_038080|LXL04_038080|OH1004|CDS

ATGGATGTACTCTTCAATTCAATCGATGTCCGGGATTTGTTATCATCACACGATCTAGACGACTCTTCGCCGCTCTCCGCCCCCGATCTCCGCCTCCTCATCGACCGTCTCCAAGTCCGTTCACTCGACATTAAGTCCAAAGTCCACAATTACATACTCGCTCACAATGATGACTTCTCTGCCCTATTCTCTCGCTGCTCCGATGCTGTCGTTAATTCCGAGCAGCTATCCGATCAAGTGTCTAACCTTGTCGATCTGTT...

Protein

Download Protein FASTA

580 aa · LXL04_038080|LXL04_038080|OH1004|PROTEIN

MDVLFNSIDVRDLLSSHDLDDSSPLSAPDLRLLIDRLQVRSLDIKSKVHNYILAHNDDFSALFSRCSDAVVNSEQLSDQVSNLVDLLSSNREPIDVKIKETVDEIRRKRVESKEKKEMLDLVKVVLKLSQELSVVENDLMAGKVVEAAEALTNLKVALGVRDNVEDVREEREPMVFGLLRKKWTDCFEEIQNLLVKFMENAVRFDQQTNAVYVKNRMGMNDSQGVELCTVVKAMHVVGILDYGLAKVADMMTKHVIAPAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038080`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038080

Location Chr09:30997028-30999932 (+)

Description Similar to ZW10: Centromere/kinetochore protein zw10 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32900`	May be required for accurate chromosome segregation.	MAG2 and three MAG2-INTERACTING PROTEINs form an ER-localized complex to facilitate storage protein transport in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12347

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038080 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000132 establishment of mitotic spindle orientation Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0007096 regulation of exit from mitosis Biological Process

GO:0015031 protein transport Biological Process

GO:0032527 protein exit from endoplasmic reticulum Biological Process

GO:0034501 protein localization to kinetochore Biological Process

KEGG gene cross-reference

ath:AT2G32900

hsa:9183

mmu:26951

pon:100171445

rno:363059

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.453

Rank 1 · LXL04_038080 · OH-1004

Nucleus0.269

Rank 2 · LXL04_038080 · OH-1004

Golgi apparatus0.251

Rank 3 · LXL04_038080 · OH-1004

Lysosome / Vacuole0.113

Rank 4 · LXL04_038080 · OH-1004

Cell membrane0.102

Rank 5 · LXL04_038080 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06248.20Zw10_N37-131 aa

PF20665.4Zw10_middle179-414 aa

PF20666.4ZW10_C442-575 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038080	`PF06248.20`	Zw10_N	37	131	1.1e-08	36.2
LXL04_038080	`PF20665.4`	Zw10_middle	179	414	3.9e-46	158.4
LXL04_038080	`PF20666.4`	ZW10_C	442	575	2.9e-36	125.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48626`	Arabidopsis thaliana	Centromere/kinetochore protein zw10 homolog	52.768%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card