LXL04_038009 | RubberDandelionOmics

Gene overview

LXL04_038009

Reference: OH-1004 Chr: Chr09 Coordinates: 28020850-28021173 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · LXL04_038009|LXL04_038009|OH1004|cDNA

ATGGTTCCATGCTCTCCATCCATTCTCTTTACCTCCACCATTCTTATTTCTCTTTTCTTCCCTTCATTCTCTCAAACTTGTTCAAATCACACTTTCATATCCAAAAGGTTCTTCACTTCTTGCAAAGACCTCCCATATCTCCATGCTCATCTCCATTGGACCTACTTCAAGTCCACAAATCAATCCCATATAGCATTTCGGGCCCCACACAAGCCCAACGGATGGATCGCATGGGCAATCAACCCATATAGAAGAAGCAT...

CDS

Download CDS FASTA

324 bp · LXL04_038009|LXL04_038009|OH1004|CDS

ATGGTTCCATGCTCTCCATCCATTCTCTTTACCTCCACCATTCTTATTTCTCTTTTCTTCCCTTCATTCTCTCAAACTTGTTCAAATCACACTTTCATATCCAAAAGGTTCTTCACTTCTTGCAAAGACCTCCCATATCTCCATGCTCATCTCCATTGGACCTACTTCAAGTCCACAAATCAATCCCATATAGCATTTCGGGCCCCACACAAGCCCAACGGATGGATCGCATGGGCAATCAACCCATATAGAAGAAGCAT...

Protein

Download Protein FASTA

107 aa · LXL04_038009|LXL04_038009|OH1004|PROTEIN

MVPCSPSILFTSTILISLFFPSFSQTCSNHTFISKRFFTSCKDLPYLHAHLHWTYFKSTNQSHIAFRAPHKPNGWIAWAINPYRRSMIGSQALIASRNTKGMWHIQQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038009`
TK1151 ID	TkA04G374020
OH-1004 ID	LXL04_038009
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 51.256 / OH-1004 95.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038009

Location Chr09:28020850-28021173 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17280`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g25290`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At5g47530`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release
`At3g07390`	One-heme-containing cytochrome.	Auxin-responsive genes AIR12 code for a new family of plasma membrane b-type cytochromes specific to flowering plants.2009 · DOI: 10.1104/pp.109.139170
`At5g48750`	Cytochrome b561 and DOMON domain-containing protein At5g48750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038009 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0030198 extracellular matrix organization Biological Process

GO:0080022 primary root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT3G07390

ath:AT3G25290

ath:AT4G17280

ath:AT5G47530

ath:AT5G48750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.372

Rank 1 · LXL04_038009 · OH-1004

Cell membrane0.182

Rank 2 · LXL04_038009 · OH-1004

Endoplasmic reticulum0.143

Rank 3 · LXL04_038009 · OH-1004

Lysosome / Vacuole0.120

Rank 4 · LXL04_038009 · OH-1004

Cytoplasm0.116

Rank 5 · LXL04_038009 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYH6`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At4g17280	46.875%	Swiss-Prot	moderate database homology
`Q9LSE7`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At3g25290	45.882%	Swiss-Prot	moderate database homology
`Q9FGK4`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At5g47530	41.975%	Swiss-Prot	moderate database homology
`Q94BT2`	Arabidopsis thaliana	Auxin-induced in root cultures protein 12	44.944%	Swiss-Prot	moderate database homology
`Q9FKC1`	Arabidopsis thaliana	Cytochrome b561 and DOMON domain-containing protein At5g48750	41.333%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card