LXL04_037959 | RubberDandelionOmics

Gene overview

LXL04_037959

Reference: OH-1004 Chr: Chr09 Coordinates: 26900134-26903776 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2271 bp · LXL04_037959|LXL04_037959|OH1004|cDNA

ATGGATGATTCAGAGGGAACTGTTATCAATGCTCCTACAGCTGAAGAGATGGCTCTTAGTGGTTTCTTCTCCACATTCTTGGACGACAAATCATACAGTACAGCTGTAGCAGCAGTTATTGTCGCCATTGCTGTCCCACTGGTTCTTTCCTCCATGTTCATGGGGAAGAACAAGAAGGCGAAACAAAGAGGTGTTCCTGTTGAAGTAGGTGGTGAGCCAGGTTTTGCCATGCGTAATGCCAGATCAAGCAAACTAGTTGA...

CDS

Download CDS FASTA

2271 bp · LXL04_037959|LXL04_037959|OH1004|CDS

ATGGATGATTCAGAGGGAACTGTTATCAATGCTCCTACAGCTGAAGAGATGGCTCTTAGTGGTTTCTTCTCCACATTCTTGGACGACAAATCATACAGTACAGCTGTAGCAGCAGTTATTGTCGCCATTGCTGTCCCACTGGTTCTTTCCTCCATGTTCATGGGGAAGAACAAGAAGGCGAAACAAAGAGGTGTTCCTGTTGAAGTAGGTGGTGAGCCAGGTTTTGCCATGCGTAATGCCAGATCAAGCAAACTAGTTGA...

Protein

Download Protein FASTA

756 aa · LXL04_037959|LXL04_037959|OH1004|PROTEIN

MDDSEGTVINAPTAEEMALSGFFSTFLDDKSYSTAVAAVIVAIAVPLVLSSMFMGKNKKAKQRGVPVEVGGEPGFAMRNARSSKLVEVPWEGATTMAALFEQSCKKHSQHRFLGTRKVVERDFITGSDGRKFEKLHLGEYQWETYGKTFERVSNFASGLIHLGHDPETRIAIFSDTRAEWFIAFQARSINILYLPPSFCYIGTLITSVLWFQGCFRQNITVVTIYASLGDDALIHSLNETKVSTLICDSKLMKKVASVSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037959`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037959

Location Chr09:26900134-26903776 (+)

Description Similar to LACS8: Long chain acyl-CoA synthetase 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04350`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	No verified direct reference in this release
`At1g77590`	Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation.	Fatty acid export from the chloroplast. Molecular characterization of a major plastidial acyl-coenzyme A synthetase from Arabidopsis.2002 · DOI: 10.1104/pp.003251

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037959 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001676 long-chain fatty acid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0034379 very-low-density lipoprotein particle assembly Biological Process

GO:0035336 long-chain fatty-acyl-CoA metabolic process Biological Process

GO:0035338 long-chain fatty-acyl-CoA biosynthetic process Biological Process

GO:0042998 positive regulation of Golgi to plasma membrane protein transport Biological Process

GO:0044539 long-chain fatty acid import into cell Biological Process

GO:0051047 positive regulation of secretion Biological Process

GO:2001247 positive regulation of phosphatidylcholine biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G77590

ath:AT2G04350

hsa:2181

pon:100174659

rno:114024

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.475

Rank 1 · LXL04_037959 · OH-1004

Mitochondrion0.159

Rank 2 · LXL04_037959 · OH-1004

Cytoplasm0.150

Rank 3 · LXL04_037959 · OH-1004

Peroxisome0.119

Rank 4 · LXL04_037959 · OH-1004

Cell membrane0.094

Rank 5 · LXL04_037959 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding136-186 aa

PF00501.35AMP-binding207-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037959	`PF00501.35`	AMP-binding	136	186	1.4e-78	265.1
LXL04_037959	`PF00501.35`	AMP-binding	207	577	1.4e-78	265.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJD4`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 8	68.234%	Swiss-Prot	strong database homology
`Q9CAP8`	Arabidopsis thaliana	Long chain acyl-CoA synthetase 9, chloroplastic	63.357%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card