LXL04_037947 | RubberDandelionOmics

Gene overview

LXL04_037947

Reference: OH-1004 Chr: Chr09 Coordinates: 25971592-25975292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3120 bp · LXL04_037947|LXL04_037947|OH1004|cDNA

ATGAAAGTATTAAACCTTTCTTTCATGGTTACATTCTTGAGTCACTTCAACTTGTTGCAAACCATCTCACTGTTATACTTTTTCTTCACACTCACATGCAATGGATTATCACTAAGCCATGATGATGAATGTTCGGCCTTGTTTCAGTTTAAGCAAAGCATAATATATCAAGTTGATGAAGCACTATATTCTTGGAAACCCAAAAGAAACGCATCAGATGCTGATTTTGATTGTTGTTCATGGTTTGGGGTGGAGTGCAG...

CDS

Download CDS FASTA

3120 bp · LXL04_037947|LXL04_037947|OH1004|CDS

ATGAAAGTATTAAACCTTTCTTTCATGGTTACATTCTTGAGTCACTTCAACTTGTTGCAAACCATCTCACTGTTATACTTTTTCTTCACACTCACATGCAATGGATTATCACTAAGCCATGATGATGAATGTTCGGCCTTGTTTCAGTTTAAGCAAAGCATAATATATCAAGTTGATGAAGCACTATATTCTTGGAAACCCAAAAGAAACGCATCAGATGCTGATTTTGATTGTTGTTCATGGTTTGGGGTGGAGTGCAG...

Protein

Download Protein FASTA

1039 aa · LXL04_037947|LXL04_037947|OH1004|PROTEIN

MKVLNLSFMVTFLSHFNLLQTISLLYFFFTLTCNGLSLSHDDECSALFQFKQSIIYQVDEALYSWKPKRNASDADFDCCSWFGVECSNDGHVISLDLSERFLGGHINSTNTLFSLVHLQSLNLAMNYFNESQIPSEIARLKQLRRLNLSDSGFSGQIPSEISQLTQLSSLDLSRNPLKLQNPSGLKNLVQNLTGLEELHLSGVDISSSVPHLLANLSSLKSLMLQNCMLQNEFPSAILELPNLKVLNVYSNANLTGFFPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037947`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037947

Location Chr09:25971592-25975292 (-)

Description Similar to RLP7: Receptor-like protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At1g45616`	Receptor-like protein 6.	No verified direct reference in this release
`At3g11010`	Receptor-like protein 34.	No verified direct reference in this release
`At4g13920`	Receptor-like protein 50.	No verified direct reference in this release
`At5g27060`	Receptor-like protein 53.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037947 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0051707 response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT3G11010

ath:AT4G13920

ath:AT5G27060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854

Rank 1 · LXL04_037947 · OH-1004

Endoplasmic reticulum0.101

Rank 2 · LXL04_037947 · OH-1004

Cytoplasm0.063

Rank 3 · LXL04_037947 · OH-1004

Nucleus0.055

Rank 4 · LXL04_037947 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_037947 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_240-87 aa

PF23598.2LRR_14102-296 aa

PF13855.13LRR_8267-324 aa

PF23598.2LRR_14283-479 aa

PF13855.13LRR_8629-688 aa

PF23211.1LRR_LRWD1797-882 aa

PF07939.17DUF1685999-1039 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037947	`PF08263.18`	LRRNT_2	40	87	2.4e-07	31.6
LXL04_037947	`PF23598.2`	LRR_14	102	296	1.4e-33	116.9
LXL04_037947	`PF13855.13`	LRR_8	267	324	6.9e-37	125.7
LXL04_037947	`PF23598.2`	LRR_14	283	479	1.4e-33	116.9
LXL04_037947	`PF13855.13`	LRR_8	629	688	6.9e-37	125.7
LXL04_037947	`PF23211.1`	LRR_LRWD1	797	882	1.1e-07	32.5
LXL04_037947	`PF07939.17`	DUF1685	999	1039	1.7e-19	70.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	39.425%	Swiss-Prot	moderate database homology
`Q9C637`	Arabidopsis thaliana	Receptor-like protein 6	36.757%	Swiss-Prot	moderate database homology
`Q9SRL2`	Arabidopsis thaliana	Receptor-like protein 34	35.845%	Swiss-Prot	moderate database homology
`Q93YT3`	Arabidopsis thaliana	Receptor-like protein 50	33.058%	Swiss-Prot	moderate database homology
`Q9S9U3`	Arabidopsis thaliana	Receptor-like protein 53	33.761%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card