LXL04_037847 | RubberDandelionOmics

Gene overview

LXL04_037847

Reference: OH-1004 Chr: Chr09 Coordinates: 22526452-22527084 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · LXL04_037847|LXL04_037847|OH1004|cDNA

ATGGCAAAGCTTATAGCCCTCGCTCTCGCCTTCTCAGCCTTCGTAGTCATTGCCACCGCCCACACCACCATCATCACCACCACCATTGAGGACGAAACCCCAATCTCGCGGCAACAATGCAGCCGACAGGTCCAGGGACAGCGACTTAACCAATGTCAGCAATACCTCCAACAGGACGAGAGCTGGATCGAGAAAATCATCCCCGGTCAGATGCAAAGCGGCCTACAATCATGCTGCCAGGAGCTCCAAAACGTGGAGGA...

CDS

Download CDS FASTA

633 bp · LXL04_037847|LXL04_037847|OH1004|CDS

ATGGCAAAGCTTATAGCCCTCGCTCTCGCCTTCTCAGCCTTCGTAGTCATTGCCACCGCCCACACCACCATCATCACCACCACCATTGAGGACGAAACCCCAATCTCGCGGCAACAATGCAGCCGACAGGTCCAGGGACAGCGACTTAACCAATGTCAGCAATACCTCCAACAGGACGAGAGCTGGATCGAGAAAATCATCCCCGGTCAGATGCAAAGCGGCCTACAATCATGCTGCCAGGAGCTCCAAAACGTGGAGGA...

Protein

Download Protein FASTA

210 aa · LXL04_037847|LXL04_037847|OH1004|PROTEIN

MAKLIALALAFSAFVVIATAHTTIITTTIEDETPISRQQCSRQVQGQRLNQCQQYLQQDESWIEKIIPGQMQSGLQSCCQELQNVEEQCQCAAVKEAFRQAQRTQQQQQQGSFGAQEIRQLKQKAQDLPNQCRLQTRQCQVGPISVTTTITDEINPTQMCQHIRGRRFNQCQSFIERQIGTLLMSVSRKGQEGVQQCCNELQNVLRINTH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037847`
TK1151 ID	TkA04G356420
OH-1004 ID	LXL04_037847
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	28.300
Protein coverage (%)	TK1151 78.740 / OH-1004 49.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037847

Location Chr09:22526452-22527084 (-)

Description Similar to HAG5: 2S seed storage protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54740`	This is a 2S seed storage protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037847 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009555 pollen development Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000322 storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0033095 aleurone grain Cellular Component

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT5G54740

rcu:8280732

rcu:8280733

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.521

Rank 1 · LXL04_037847 · OH-1004

Cytoplasm0.235

Rank 2 · LXL04_037847 · OH-1004

Lysosome / Vacuole0.108

Rank 3 · LXL04_037847 · OH-1004

Endoplasmic reticulum0.095

Rank 4 · LXL04_037847 · OH-1004

Nucleus0.083

Rank 5 · LXL04_037847 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00234.28Tryp_alpha_amyl40-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037847	`PF00234.28`	Tryp_alpha_amyl	40	139	4.2e-06	27.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH31`	Arabidopsis thaliana	2S seed storage protein 5	28.125%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card