LXL04_037592 | RubberDandelionOmics

Gene overview

LXL04_037592

Reference: OH-1004 Chr: Chr09 Coordinates: 15557691-15558785 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

918 bp · LXL04_037592|LXL04_037592|OH1004|cDNA

GTTCATTCCATATTTCCATCCTCAACCACACACGTGTCACCATTCACTCTCTACACATACCCACACCCTCACAACCTTCTCCATCATCACCACCACCACTTACCTTCTTCTCTTGAACCATCAATGGCCGCCGCCGCTAGCTCCACCACCGTGGTCCGCGCTACCCCATTCTTGGGTCAAACCAGAACATCGAGCCTCAACCCTCTAAGAGATGTCGTCTCCATGCCCAGTTCAAAATACACCATGGGTAACGACTTGTG...

CDS

Download CDS FASTA

795 bp · LXL04_037592|LXL04_037592|OH1004|CDS

ATGGCCGCCGCCGCTAGCTCCACCACCGTGGTCCGCGCTACCCCATTCTTGGGTCAAACCAGAACATCGAGCCTCAACCCTCTAAGAGATGTCGTCTCCATGCCCAGTTCAAAATACACCATGGGTAACGACTTGTGGTACGGACCTGACCGAGTCAAATACTTGGGACCGTTTTCCGCTCAGACCCCATCGTACTTGACCGGAGAATTTCCCGGCGACTACGGTTGGGACACCGCCGGTTTGTCAGCTGACCCAGAAGC...

Protein

Download Protein FASTA

264 aa · LXL04_037592|LXL04_037592|OH1004|PROTEIN

MAAAASSTTVVRATPFLGQTRTSSLNPLRDVVSMPSSKYTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGAFGCITPEVLEKWVKVDFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLEGVGEGNNLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037592`
TK1151 ID	TkA04G327950
OH-1004 ID	LXL04_037592
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 83.607 / OH-1004 96.591 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037592

Location Chr09:15557691-15558785 (-)

Description Similar to CAB13: Chlorophyll a-b binding protein 13, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54270`	The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated.	The photosystem II light-harvesting protein Lhcb3 affects the macrostructure of photosystem II and the rate of state transitions in Arabidopsis.2009 · DOI: 10.1105/tpc.108.064006 Excitation energy transfer and charge separation are affected in Arabidopsis thaliana mutants lacking light-harvesting chlorophyll a/b binding protein Lhcb3.2015 · DOI: 10.1016/j.jphotobiol.2015.11.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037592 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009765 photosynthesis, light harvesting Biological Process

GO:0009768 photosynthesis, light harvesting in photosystem I Biological Process

GO:0009769 photosynthesis, light harvesting in photosystem II Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0015979 photosynthesis Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009517 PSII associated light-harvesting complex II Cellular Component

GO:0009522 photosystem I Cellular Component

KEGG gene cross-reference

ath:AT5G54270

ghi:107954948

sly:101243766

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.987

Rank 1 · LXL04_037592 · OH-1004

Mitochondrion0.024

Rank 2 · LXL04_037592 · OH-1004

Cytoplasm0.013

Rank 3 · LXL04_037592 · OH-1004

Peroxisome0.009

Rank 4 · LXL04_037592 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_037592 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00504.29Chloroa_b-bind63-230 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037592	`PF00504.29`	Chloroa_b-bind	63	230	1.7e-50	172.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7M0`	Arabidopsis thaliana	Chlorophyll a-b binding protein 3, chloroplastic	91.506%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card