Gene Card
Gene overview
cDNA / CDS / Protein Sequences
324 bp · LXL04_037584|LXL04_037584|OH1004|cDNA
ATGTTGGAAGGAAAAGCTGTGATCGGGGAGACTGATATGCGTAAAACCATGCAAGAAGATGCTCTTCAACTCGCAGCTAAAGCACTCGACTTTTTTGATGTAACTGAAGCCACTGAAATAGCCCGAGTCATTAAACAGGAATTCGATAGGATGTATGGAGGTGGTTGGCAGTGTATTGTAGGGACTGATTTTGGGTCGTTTGTGACTCATTGTTTTGGGtcttttattcatttttctATTGGGAATCTTTCGATTTTGCT...
324 bp · LXL04_037584|LXL04_037584|OH1004|CDS
ATGTTGGAAGGAAAAGCTGTGATCGGGGAGACTGATATGCGTAAAACCATGCAAGAAGATGCTCTTCAACTCGCAGCTAAAGCACTCGACTTTTTTGATGTAACTGAAGCCACTGAAATAGCCCGAGTCATTAAACAGGAATTCGATAGGATGTATGGAGGTGGTTGGCAGTGTATTGTAGGGACTGATTTTGGGTCGTTTGTGACTCATTGTTTTGGGTCTTTTATTCATTTTTCTATTGGGAATCTTTCGATTTTGCT...
Protein
Download Protein FASTA107 aa · LXL04_037584|LXL04_037584|OH1004|PROTEIN
MLEGKAVIGETDMRKTMQEDALQLAAKALDFFDVTEATEIARVIKQEFDRMYGGGWQCIVGTDFGSFVTHCFGSFIHFSIGNLSILLFRGSAAPENNGFSTLEGVKA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037584 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037584 |
|---|---|
| Location | Chr09:15390661-15391108 (+) |
| Description | Similar to Dynein light chain LC6, flagellar outer arm |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000132 establishment of mitotic spindle orientation Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0007283 spermatogenesis Biological Process GO:0007286 spermatid development Biological Process GO:0007290 spermatid nucleus elongation Biological Process GO:0007291 sperm individualization Biological Process GO:0030473 nuclear migration along microtubule Biological Process GO:0031507 heterochromatin formation Biological Process GO:0034454 microtubule anchoring at centrosome Biological Process GO:0035721 intraciliary retrograde transport Biological Process GO:0042326 negative regulation of phosphorylation Biological Process |
| KEGG gene cross-reference | cel:CELE_T26A5.9 dme:Dmel_CG6998 ocu:100008650 rno:58945 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01221.24Dynein_light5-89 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037584 | PF01221.24 | Dynein_light | 5 | 89 | 9.7e-32 | 109.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.