Gene Card
Gene overview
cDNA / CDS / Protein Sequences
561 bp · LXL04_037503|LXL04_037503|OH1004|cDNA
ATGGCTCCTGCCGTTCCTAGATCCGGTGACGCTATTTTTGCCAACGTCGAGCGAGTGAACGCTGAGCTGTTCACTCTGACATATGGAGCGATCGTGCGACAATTGCTTACAGATCTGGAGGAAGTTGAGGAAGTCAACAAGCAGCTCGATCAAATGGGCTACAACATTGGAATCCGTCTAATCGATGAGTTTCTCGCAAAATCGAATGTCACAAGGTGCGTTGATTTTAGAGAGACAGCTGAAGTCATTGCAAAGGTTGG...
561 bp · LXL04_037503|LXL04_037503|OH1004|CDS
ATGGCTCCTGCCGTTCCTAGATCCGGTGACGCTATTTTTGCCAACGTCGAGCGAGTGAACGCTGAGCTGTTCACTCTGACATATGGAGCGATCGTGCGACAATTGCTTACAGATCTGGAGGAAGTTGAGGAAGTCAACAAGCAGCTCGATCAAATGGGCTACAACATTGGAATCCGTCTAATCGATGAGTTTCTCGCAAAATCGAATGTCACAAGGTGCGTTGATTTTAGAGAGACAGCTGAAGTCATTGCAAAGGTTGG...
Protein
Download Protein FASTA186 aa · LXL04_037503|LXL04_037503|OH1004|PROTEIN
MAPAVPRSGDAIFANVERVNAELFTLTYGAIVRQLLTDLEEVEEVNKQLDQMGYNIGIRLIDEFLAKSNVTRCVDFRETAEVIAKVGFKMFLGVTASVTNWDNEGTCCSLILEDNPLVDFVELPDTCQGLYYCNILSGVVRGALEMVSMKTEITWIRDMLRGDDAFELQVKLLKQVPEEYPYKDDE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037503 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037503 |
|---|---|
| Location | Chr09:12409051-12409948 (+) |
| Description | Similar to TRAPPC3: Trafficking protein particle complex subunit 3 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006891 intra-Golgi vesicle-mediated transport Biological Process GO:0006901 vesicle coating Biological Process GO:0016236 macroautophagy Biological Process GO:0048208 COPII vesicle coating Biological Process GO:0099022 vesicle tethering Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0030008 TRAPP complex Cellular Component GO:0033106 cis-Golgi network membrane Cellular Component |
| KEGG gene cross-reference | ddi:DDB_G0277135 gga:419625 hsa:27095 mmu:27096 rno:362599 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04051.22TRAPP24-171 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037503 | PF04051.22 | TRAPP | 24 | 171 | 1.3e-42 | 145.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.