LXL04_037375 | RubberDandelionOmics

Gene overview

LXL04_037375

Reference: OH-1004 Chr: Chr09 Coordinates: 8732427-8733026 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · LXL04_037375|LXL04_037375|OH1004|cDNA

ATGGAAgATAGACCAAGAGAACCTGCAAATTGGAGTGAAATTGCACATGTTGTAGTTGCTCTTTCTATTCCAGTCATTGCCAATGGTGATGTATTGGAATGTCAAGATTTTCAGAATATTCGAGATGTGACTGGGGCATCTTCTCTGATGGTTGCTAGGGGTGCAATTTGGAATGCTTCGATTTTTAGTCATGAAGAAACACGTTTTGAAGAAGTGAAAAGAGAGTATGTTAGGAAGAGCATTATATGGGATCACGATAT...

CDS

Download CDS FASTA

342 bp · LXL04_037375|LXL04_037375|OH1004|CDS

ATGGAAGATAGACCAAGAGAACCTGCAAATTGGAGTGAAATTGCACATGTTGTAGTTGCTCTTTCTATTCCAGTCATTGCCAATGGTGATGTATTGGAATGTCAAGATTTTCAGAATATTCGAGATGTGACTGGGGCATCTTCTCTGATGGTTGCTAGGGGTGCAATTTGGAATGCTTCGATTTTTAGTCATGAAGAAACACGTTTTGAAGAAGTGAAAAGAGAGTATGTTAGGAAGAGCATTATATGGGATCACGATAT...

Protein

Download Protein FASTA

113 aa · LXL04_037375|LXL04_037375|OH1004|PROTEIN

MEDRPREPANWSEIAHVVVALSIPVIANGDVLECQDFQNIRDVTGASSLMVARGAIWNASIFSHEETRFEEVKREYVRKSIIWDHDIKSTKYTLKEMIMHYTSLELPERKGRD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037375`
TK1151 ID	TkA07G187960
OH-1004 ID	LXL04_037375
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.300
Protein coverage (%)	TK1151 81.295 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_037375`
Location	Chr09:8732427-8733026 (-)
Description	Similar to DUS2: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037375` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002943 tRNA dihydrouridine synthesis Biological Process GO:0006397 mRNA processing Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0000049 tRNA binding Molecular Function GO:0003725 double-stranded RNA binding Molecular Function GO:0004860 protein kinase inhibitor activity Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0010181 FMN binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0292686 hsa:54920 mmu:66369 nme:NMB0999 reh:H16_A1443 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · LXL04_037375 · OH-1004

Nucleus0.422

Rank 2 · LXL04_037375 · OH-1004

Mitochondrion0.092

Rank 3 · LXL04_037375 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_037375 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_037375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01207.24Dus5-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037375	`PF01207.24`	Dus	5	92	4.2e-15	56.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card