LXL04_037333 | RubberDandelionOmics

Gene overview

LXL04_037333

Reference: OH-1004 Chr: Chr09 Coordinates: 6410113-6411325 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_037333|LXL04_037333|OH1004|cDNA

ATGTTTTCATTATCTTCGGGCCGGTTGAATCTATTCAGGGAAATGGCAGCCACCGCACATTCTATTTCCACCACCATCATTGACGGCAAGGCTCCTCCACGACAATCAGCTGCCCCTGCATCCGCCCAATGTGTCACCCTTCCGTCTCCCACGTCCCCACCTCTCAAGCAACAGAACCGGGCTTGGAAGGCAACCGGCTACTGTGGAAAGTTAGCTCGGAATGTTGCTGCTATGGCCACCGGAGAGGCACCCGCTGAGGC...

CDS

Download CDS FASTA

552 bp · LXL04_037333|LXL04_037333|OH1004|CDS

ATGTTTTCATTATCTTCGGGCCGGTTGAATCTATTCAGGGAAATGGCAGCCACCGCACATTCTATTTCCACCACCATCATTGACGGCAAGGCTCCTCCACGACAATCAGCTGCCCCTGCATCCGCCCAATGTGTCACCCTTCCGTCTCCCACGTCCCCACCTCTCAAGCAACAGAACCGGGCTTGGAAGGCAACCGGCTACTGTGGAAAGTTAGCTCGGAATGTTGCTGCTATGGCCACCGGAGAGGCACCCGCTGAGGC...

Protein

Download Protein FASTA

183 aa · LXL04_037333|LXL04_037333|OH1004|PROTEIN

MFSLSSGRLNLFREMAATAHSISTTIIDGKAPPRQSAAPASAQCVTLPSPTSPPLKQQNRAWKATGYCGKLARNVAAMATGEAPAEAVSTDLPELIKPVQEAWDKIEDKYAVSSLAVAGVVFLWGSAGMISAIDRLPLIPGVLELVGIGCSGWFAYKNLVFKPDREALIEKIKCTYKDIIGTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037333`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037333

Location Chr09:6410113-6411325 (-)

Description Similar to CURT1B: Protein CURVATURE THYLAKOID 1B, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46820`	Determines thylakoid architecture by inducing membrane curvature.	No verified direct reference in this release
`At1g52220`	Determines thylakoid architecture by inducing membrane curvature.	No verified direct reference in this release
`At4g01150`	Determines thylakoid architecture by inducing membrane curvature.	Arabidopsis CURVATURE THYLAKOID1 proteins modify thylakoid architecture by inducing membrane curvature.2013 · DOI: 10.1105/tpc.113.113118
`At4g38100`	Determines thylakoid architecture by inducing membrane curvature.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037333 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006438 valyl-tRNA aminoacylation Biological Process

GO:0009773 photosynthetic electron transport in photosystem I Biological Process

GO:0090391 granum assembly Biological Process

GO:0097753 membrane bending Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009515 granal stacked thylakoid Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ana:all1318

ath:AT1G52220

ath:AT2G46820

ath:AT4G01150

ath:AT4G38100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · LXL04_037333 · OH-1004

Mitochondrion0.022

Rank 2 · LXL04_037333 · OH-1004

Nucleus0.014

Rank 3 · LXL04_037333 · OH-1004

Cytoplasm0.012

Rank 4 · LXL04_037333 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_037333 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14159.12CAAD99-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037333	`PF14159.12`	CAAD	99	181	5.9e-28	97.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LCA1`	Arabidopsis thaliana	Protein CURVATURE THYLAKOID 1B, chloroplastic	59.429%	Swiss-Prot	strong database homology
`Q9M812`	Arabidopsis thaliana	Protein CURVATURE THYLAKOID 1C, chloroplastic	42.105%	Swiss-Prot	moderate database homology
`O04616`	Arabidopsis thaliana	Protein CURVATURE THYLAKOID 1A, chloroplastic	37.719%	Swiss-Prot	moderate database homology
`Q8LDD3`	Arabidopsis thaliana	Protein CURVATURE THYLAKOID 1D, chloroplastic	29.524%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card