LXL04_037254 | RubberDandelionOmics

Gene overview

LXL04_037254

Reference: OH-1004 Chr: Chr09 Coordinates: 4251235-4258601 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_037254|LXL04_037254|OH1004|cDNA

ATGATCGGAACCCTAAGAACACCTACCATCGGAATCTCTCTCCGCCTACCTCCTCCCAATTCCACCGGATCTACCACCTCGAAAGTATTTTTAGGTCGCCGACGCACCTGCAAAGCCTCGATGCACGCCGTTCTCGACGTCGCAATTAGGAGACCGGAGAGTCTATACGAGGTGTTACGAGTTGAAAGAAACGCATCGCGTACAGAGATTAAGACAGCTTACCGGAGTTTGGCGAAGCTGTACCATCCAGACGCTTCCGA...

CDS

Download CDS FASTA

465 bp · LXL04_037254|LXL04_037254|OH1004|CDS

ATGATCGGAACCCTAAGAACACCTACCATCGGAATCTCTCTCCGCCTACCTCCTCCCAATTCCACCGGATCTACCACCTCGAAAGTATTTTTAGGTCGCCGACGCACCTGCAAAGCCTCGATGCACGCCGTTCTCGACGTCGCAATTAGGAGACCGGAGAGTCTATACGAGGTGTTACGAGTTGAAAGAAACGCATCGCGTACAGAGATTAAGACAGCTTACCGGAGTTTGGCGAAGCTGTACCATCCAGACGCTTCCGA...

Protein

Download Protein FASTA

154 aa · LXL04_037254|LXL04_037254|OH1004|PROTEIN

MIGTLRTPTIGISLRLPPPNSTGSTTSKVFLGRRRTCKASMHAVLDVAIRRPESLYEVLRVERNASRTEIKTAYRSLAKLYHPDASDFRQSSVGDRDFIEIHNAYETLSDPEARAVYDLKWSTGLRRKSGLYTTVGKRQGIYTCRRWETDQCCK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037254`
TK1151 ID	TkAUNG097740
OH-1004 ID	LXL04_037254
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.500
Protein coverage (%)	TK1151 24.653 / OH-1004 43.506 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037254

Location Chr09:4251235-4258601 (+)

Description Similar to ATJ11: Chaperone protein dnaJ 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36040`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0334400`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release
`Os05g0334000`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release
`Os05g0333500`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037254 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G36040

dosa:Os05g0333500

dosa:Os05g0334400

osa:107275576

osa:4338449

osa:4338452

tte:TTE0956

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.950

Rank 1 · LXL04_037254 · OH-1004

Mitochondrion0.052

Rank 2 · LXL04_037254 · OH-1004

Nucleus0.030

Rank 3 · LXL04_037254 · OH-1004

Cytoplasm0.016

Rank 4 · LXL04_037254 · OH-1004

Cell membrane0.008

Rank 5 · LXL04_037254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ55-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037254	`PF00226.37`	DnaJ	55	118	1.4e-20	73.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYB5`	Arabidopsis thaliana	Chaperone protein dnaJ 11, chloroplastic	51.456%	Swiss-Prot	moderate database homology
`P0DO03`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A8, chloroplastic	44.872%	Swiss-Prot	moderate database homology
`P0DO02`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A7B, chloroplastic	44.872%	Swiss-Prot	moderate database homology
`P0DO01`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A7A, chloroplastic	44.872%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card