LXL04_037127 | RubberDandelionOmics

Gene overview

LXL04_037127

Reference: OH-1004 Chr: Chr08 Coordinates: 53690571-53691395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · LXL04_037127|LXL04_037127|OH1004|cDNA

ATGCTAATCAGTGGCTGCTTATATATTAATTATCTGCATTGGATTTTGAAGCATGATGATTGGAATCTCGAAGAAGATTCGAAGGCTCTTGAGCTATTGCCGGTGTTGATTGCTTTGTTAGACGAATACACACTAGTCAGCCCTGTCAGGTTGGATATTGCAGCCAGATTTGGTGCTGTTTACAGGCAGGTTTCCTTATGCAATGCTTTTGGTGCTGTTTACAAGCAGGTTTCCTTATGCAATGCCAGATTTGGTGCTGT...

CDS

Download CDS FASTA

369 bp · LXL04_037127|LXL04_037127|OH1004|CDS

ATGCTAATCAGTGGCTGCTTATATATTAATTATCTGCATTGGATTTTGAAGCATGATGATTGGAATCTCGAAGAAGATTCGAAGGCTCTTGAGCTATTGCCGGTGTTGATTGCTTTGTTAGACGAATACACACTAGTCAGCCCTGTCAGGTTGGATATTGCAGCCAGATTTGGTGCTGTTTACAGGCAGGTTTCCTTATGCAATGCTTTTGGTGCTGTTTACAAGCAGGTTTCCTTATGCAATGCCAGATTTGGTGCTGT...

Protein

Download Protein FASTA

122 aa · LXL04_037127|LXL04_037127|OH1004|PROTEIN

MLISGCLYINYLHWILKHDDWNLEEDSKALELLPVLIALLDEYTLVSPVRLDIAARFGAVYRQVSLCNAFGAVYKQVSLCNARFGAVYRQAAGKYKQDGKTYVVQDGDIIFFKFNVSGGGKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037127`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037127

Location Chr08:53690571-53691395 (+)

Description Similar to YchF1: Obg-like ATPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30580`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	The unconventional P-loop NTPase OsYchF1 and its regulator OsGAP1 play opposite roles in salinity stress tolerance.2013 · DOI: 10.1111/pce.12108

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0199300`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080 ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses.2016 · DOI: 10.1073/pnas.1522966113
`UniProt: B8BBN7`	Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037127 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0042595 behavioral response to starvation Biological Process

GO:0043052 thermotaxis Biological Process

GO:0046034 ATP metabolic process Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1901001 negative regulation of response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G30580

cel:CELE_W08E3.3

dosa:Os08g0199300

rno:296488

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.415

Rank 1 · LXL04_037127 · OH-1004

Mitochondrion0.201

Rank 2 · LXL04_037127 · OH-1004

Nucleus0.200

Rank 3 · LXL04_037127 · OH-1004

Peroxisome0.135

Rank 4 · LXL04_037127 · OH-1004

Extracellular0.108

Rank 5 · LXL04_037127 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06071.20YchF-GTPase_C89-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037127	`PF06071.20`	YchF-GTPase_C	89	115	2.7e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA73`	Arabidopsis thaliana	Obg-like ATPase 1	90.909%	Swiss-Prot	weak database homology
`Q6Z1J6`	Oryza sativa subsp. japonica	Obg-like ATPase 1	90.909%	Swiss-Prot	weak database homology
`B8BBN7`	Oryza sativa subsp. indica	Obg-like ATPase 1	87.879%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card