LXL04_037077 | RubberDandelionOmics

Gene overview

LXL04_037077

Reference: OH-1004 Chr: Chr08 Coordinates: 52725942-52726997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_037077|LXL04_037077|OH1004|cDNA

ATGACTGATGAGGAACCAAAGGCTCTCAATTATGTGTCAGAGATTGTGTTAAAAAAAAGGAAAACCAATGAGGACTGGGCCAATAGAAGGAAGGAACAGTTGGAGCAAAGGGTGAAGAAATCTAAAAGTGATAGTTTCGTTATCAAAAAACCCGAACAATTTATCAGAGAATACCGTGATAAAGAGGCAGACCTTATAAAAATGAAATATCGTGGAAAACGAACTATTAAAAAGTCCATGTTTCCACAATCAAAACTCCT...

CDS

Download CDS FASTA

738 bp · LXL04_037077|LXL04_037077|OH1004|CDS

ATGACTGATGAGGAACCAAAGGCTCTCAATTATGTGTCAGAGATTGTGTTAAAAAAAAGGAAAACCAATGAGGACTGGGCCAATAGAAGGAAGGAACAGTTGGAGCAAAGGGTGAAGAAATCTAAAAGTGATAGTTTCGTTATCAAAAAACCCGAACAATTTATCAGAGAATACCGTGATAAAGAGGCAGACCTTATAAAAATGAAATATCGTGGAAAACGAACTATTAAAAAGTCCATGTTTCCACAATCAAAACTCCT...

Protein

Download Protein FASTA

245 aa · LXL04_037077|LXL04_037077|OH1004|PROTEIN

MTDEEPKALNYVSEIVLKKRKTNEDWANRRKEQLEQRVKKSKSDSFVIKKPEQFIREYRDKEADLIKMKYRGKRTIKKSMFPQSKLLFVIRIQGKSDMHPQTRKLLYSLRLRRMFTGVFVKANERIMDILQKVEPYVTYGYPNLKSVNEIIYKKGLAKINKQIFPLTDNNIIEKEMSKHGIICIEDIVKEIANVGPHFKDVCSFLCPFNLNKPEKALQGKKKPYRDGGDSGNREDQINELISKMN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037077`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037077

Location Chr08:52725942-52726997 (-)

Description Similar to RPL7A: 60S ribosomal protein L7-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80750`	Large ribosomal subunit protein uL30z.	No verified direct reference in this release
`At2g01250`	Large ribosomal subunit protein uL30y.	No verified direct reference in this release
`At3g13580`	Large ribosomal subunit protein uL30w.	No verified direct reference in this release
`At2g44120`	Large ribosomal subunit protein uL30x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037077 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G80750

ath:AT2G01250

ath:AT2G44120

ath:AT3G13580

gga:420182

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503

Rank 1 · LXL04_037077 · OH-1004

Nucleus0.259

Rank 2 · LXL04_037077 · OH-1004

Mitochondrion0.104

Rank 3 · LXL04_037077 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_037077 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_037077 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08079.18Ribosomal_L30_N12-70 aa

PF00327.26Ribosomal_L3087-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037077	`PF08079.18`	Ribosomal_L30_N	12	70	4.7e-09	37.2
LXL04_037077	`PF00327.26`	Ribosomal_L30	87	137	2.6e-13	50.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAI5`	Arabidopsis thaliana	Large ribosomal subunit protein uL30z	53.600%	Swiss-Prot	strong database homology
`P60040`	Arabidopsis thaliana	Large ribosomal subunit protein uL30y	50.213%	Swiss-Prot	strong database homology
`Q9LHP1`	Arabidopsis thaliana	Large ribosomal subunit protein uL30w	47.561%	Swiss-Prot	moderate database homology
`P60039`	Arabidopsis thaliana	Large ribosomal subunit protein uL30x	48.511%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card