LXL04_037068 | RubberDandelionOmics

Gene overview

LXL04_037068

Reference: OH-1004 Chr: Chr08 Coordinates: 52550379-52550972 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · LXL04_037068|LXL04_037068|OH1004|cDNA

ATGAGTCGAGTAGCAGGAGCAAAGGGGGGAAAGAAGAAGACGGCTACTTTTGTGATTGATTGTGGGAAGCCTGTTGAGGATAAGATCATGGAGATTGCCTCACTTGAGAAGTTTCTTCAGGAGAGAATCAAGGTCGGTGGTAAAGCTGGTAATCTCGGAGATTCCGTTACTATTTCCCGtgaaaagaacaagatctccgTCACCTCCGACAGCAACTTCTCCAAAAGGTACCTGAAATACTTGACGAAGAAGTACTTGAA...

CDS

Download CDS FASTA

372 bp · LXL04_037068|LXL04_037068|OH1004|CDS

ATGAGTCGAGTAGCAGGAGCAAAGGGGGGAAAGAAGAAGACGGCTACTTTTGTGATTGATTGTGGGAAGCCTGTTGAGGATAAGATCATGGAGATTGCCTCACTTGAGAAGTTTCTTCAGGAGAGAATCAAGGTCGGTGGTAAAGCTGGTAATCTCGGAGATTCCGTTACTATTTCCCGTGAAAAGAACAAGATCTCCGTCACCTCCGACAGCAACTTCTCCAAAAGGTACCTGAAATACTTGACGAAGAAGTACTTGAA...

Protein

Download Protein FASTA

123 aa · LXL04_037068|LXL04_037068|OH1004|PROTEIN

MSRVAGAKGGKKKTATFVIDCGKPVEDKIMEIASLEKFLQERIKVGGKAGNLGDSVTISREKNKISVTSDSNFSKRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIAENEGEEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037068`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037068

Location Chr08:52550379-52550972 (+)

Description Similar to RPL22B: 60S ribosomal protein L22-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05560`	Large ribosomal subunit protein eL22z.	No verified direct reference in this release
`At5g27770`	Large ribosomal subunit protein eL22y.	No verified direct reference in this release
`At1g02830`	Large ribosomal subunit protein eL22x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037068 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0030684 preribosome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G02830

ath:AT3G05560

ath:AT5G27770

ddi:DDB_G0288101

spo:2543021

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.703

Rank 1 · LXL04_037068 · OH-1004

Nucleus0.476

Rank 2 · LXL04_037068 · OH-1004

Endoplasmic reticulum0.074

Rank 3 · LXL04_037068 · OH-1004

Cell membrane0.047

Rank 4 · LXL04_037068 · OH-1004

Mitochondrion0.040

Rank 5 · LXL04_037068 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01776.23Ribosomal_L22e12-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037068	`PF01776.23`	Ribosomal_L22e	12	122	3.7e-47	159.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9W1`	Arabidopsis thaliana	Large ribosomal subunit protein eL22z	83.065%	Swiss-Prot	strong database homology
`Q9FE58`	Arabidopsis thaliana	Large ribosomal subunit protein eL22y	84.694%	Swiss-Prot	strong database homology
`Q9SRX7`	Arabidopsis thaliana	Large ribosomal subunit protein eL22x	72.881%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card