LXL04_037063 | RubberDandelionOmics

Gene overview

LXL04_037063

Reference: OH-1004 Chr: Chr08 Coordinates: 52498714-52505736 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3087 bp · LXL04_037063|LXL04_037063|OH1004|cDNA

ATGTCGAATGTTGTTCATCTTCTTattctctttcttcttctggTGATCGGAAGTTCTAACGATGTACGATTCTTCGTATACGGCGTGGCTGATGAATATCGAAGAGAAGATTTTCCCGCTGAATTCGTGTTTGGTTCAGGAACTTCCGCTTATCAGGTTGAAGGAGCAGTACTGGAAGATGGAAGGACTTTCAGCATTTGGGACACATTCGCTCATACAGGCTACTACAATGGAGCAAATGGAGACATAGCATGTGACGG...

CDS

Download CDS FASTA

3087 bp · LXL04_037063|LXL04_037063|OH1004|CDS

ATGTCGAATGTTGTTCATCTTCTTATTCTCTTTCTTCTTCTGGTGATCGGAAGTTCTAACGATGTACGATTCTTCGTATACGGCGTGGCTGATGAATATCGAAGAGAAGATTTTCCCGCTGAATTCGTGTTTGGTTCAGGAACTTCCGCTTATCAGGTTGAAGGAGCAGTACTGGAAGATGGAAGGACTTTCAGCATTTGGGACACATTCGCTCATACAGGCTACTACAATGGAGCAAATGGAGACATAGCATGTGACGG...

Protein

Download Protein FASTA

1028 aa · LXL04_037063|LXL04_037063|OH1004|PROTEIN

MSNVVHLLILFLLLVIGSSNDVRFFVYGVADEYRREDFPAEFVFGSGTSAYQVEGAVLEDGRTFSIWDTFAHTGYYNGANGDIACDGYHKYKEDIELMAKTGLEAFRFSISWSRLIPDGRGPVNVKGLQFYNDFINRLIAHGIQPHVTLHHDDLPQILENEYGGWLSRKSVKDYVAYADICFREFGDRVLHWTTFNEANVFTLGGYDMGFSPPGRCSTPFGLINCTVGNSTYEPYLAAHHLLLAHASTVRLYRKKYKAMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037063`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037063

Location Chr08:52498714-52505736 (-)

Description Similar to LCT: Lactase-phlorizin hydrolase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02850`	Beta-glucosidase 11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037063 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0005990 lactose catabolic process Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009725 response to hormone Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010040 response to iron(II) ion Biological Process

GO:0010045 response to nickel cation Biological Process

GO:0010288 response to lead ion Biological Process

GO:0042594 response to starvation Biological Process

GO:0043627 response to estrogen Biological Process

GO:0045471 response to ethanol Biological Process

KEGG gene cross-reference

hsa:3938

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.382

Rank 1 · LXL04_037063 · OH-1004

Cytoplasm0.191

Rank 2 · LXL04_037063 · OH-1004

Endoplasmic reticulum0.177

Rank 3 · LXL04_037063 · OH-1004

Extracellular0.102

Rank 4 · LXL04_037063 · OH-1004

Cell membrane0.079

Rank 5 · LXL04_037063 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00232.25Glyco_hydro_136-498 aa

PF00232.25Glyco_hydro_1544-1006 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037063	`PF00232.25`	Glyco_hydro_1	36	498	3.6e-279	926.5
LXL04_037063	`PF00232.25`	Glyco_hydro_1	544	1006	3.6e-279	926.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H5Q1`	Arabidopsis thaliana	Beta-glucosidase 11	58.859%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card