LXL04_037056 | RubberDandelionOmics

Gene overview

LXL04_037056

Reference: OH-1004 Chr: Chr08 Coordinates: 52452484-52459285 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3783 bp · LXL04_037056|LXL04_037056|OH1004|cDNA

ATGGTGGAAACAAGGCGGAGCTCGTCTTCCTCGAAACGCACGCTTCCTTCACCTTGTTCGTCTCCAATCCCAACAGGGAAAAGATCAAAGGCAGCGGAGGCGGCATCTTCGTCAACTACCGGGACGCCGTTGGAGCCCATTGAGGCGGTGGTGAAGGAATCCGGTGGATGCGAGTCTCAGGAACAGGAGGTCCGATCTTCTGATCCGTCAAAGAAAGACTCCGATGCCTGTGACGAAGTGCCCGGTGTTGACGTTCCTGA...

CDS

Download CDS FASTA

3783 bp · LXL04_037056|LXL04_037056|OH1004|CDS

ATGGTGGAAACAAGGCGGAGCTCGTCTTCCTCGAAACGCACGCTTCCTTCACCTTGTTCGTCTCCAATCCCAACAGGGAAAAGATCAAAGGCAGCGGAGGCGGCATCTTCGTCAACTACCGGGACGCCGTTGGAGCCCATTGAGGCGGTGGTGAAGGAATCCGGTGGATGCGAGTCTCAGGAACAGGAGGTCCGATCTTCTGATCCGTCAAAGAAAGACTCCGATGCCTGTGACGAAGTGCCCGGTGTTGACGTTCCTGA...

Protein

Download Protein FASTA

1260 aa · LXL04_037056|LXL04_037056|OH1004|PROTEIN

MVETRRSSSSSKRTLPSPCSSPIPTGKRSKAAEAASSSTTGTPLEPIEAVVKESGGCESQEQEVRSSDPSKKDSDACDEVPGVDVPEKSPVVQVEEGQPLVSPMSLGDSLIDVEKTKANGGSTVLNRTKKRQSKSNVGVAWGKLLSQCSQNPHVVMDRPIFTVGQGRQCDLWLGGDPSISKSLCSLRHIESQQGGASITLLEITGGKGVVKVNGKTCTKRSTLPLKAGDEVIFSSSGRHAYIFQQLSNDNNIGADVAPPM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037056`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_037056`
Location	Chr08:52452484-52459285 (-)
Description	Similar to atad1a: ATPase family AAA domain-containing protein 1-A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037056` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002092 positive regulation of receptor internalization Biological Process GO:0009653 anatomical structure morphogenesis Biological Process GO:0140570 extraction of mislocalized protein from mitochondrial outer membrane Biological Process GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0140567 membrane protein dislocase activity Molecular Function
KEGG gene cross-reference	bta:506045 hsa:84896 mmu:67979 rno:309532 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.552

Rank 1 · LXL04_037056 · OH-1004

Cytoplasm0.331

Rank 2 · LXL04_037056 · OH-1004

Cell membrane0.111

Rank 3 · LXL04_037056 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_037056 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_037056 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24933.2DUF7751856-917 aa

PF00004.36AAA996-1126 aa

PF17862.8AAA_lid_31151-1185 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037056	`PF24933.2`	DUF7751	856	917	1.3e-19	71.0
LXL04_037056	`PF00004.36`	AAA	996	1126	2.1e-38	132.5
LXL04_037056	`PF17862.8`	AAA_lid_3	1151	1185	1.4e-11	44.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card