RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_037018
Reference: OH-1004 Chr: Chr08 Coordinates: 51775754-51780181 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2646 bp · LXL04_037018|LXL04_037018|OH1004|cDNA

ATGGGTTCAAAGCCTTGGCTACAACCCGCTCCAACCTACCACCCATTGGAGACGTATTGGGACACTGAAGAAGATGCTCCTGGACCTAGATGTGCTCACACTCTTACTGCCGTCGCCCAAACCAAAGCTCATGGCCCTCGGCTGATCTTATTCGGTGGCGCCACCGCCATCGAAGGCGGCGCTTCCTCTCCCGTCCCCGGCATCCGGTTAGCTGGCGTGACAAATTCAGTTCATTCTTACGATGTGCTGACCAGGAAATG...

CDS

Download CDS FASTA

2646 bp · LXL04_037018|LXL04_037018|OH1004|CDS

ATGGGTTCAAAGCCTTGGCTACAACCCGCTCCAACCTACCACCCATTGGAGACGTATTGGGACACTGAAGAAGATGCTCCTGGACCTAGATGTGCTCACACTCTTACTGCCGTCGCCCAAACCAAAGCTCATGGCCCTCGGCTGATCTTATTCGGTGGCGCCACCGCCATCGAAGGCGGCGCTTCCTCTCCCGTCCCCGGCATCCGGTTAGCTGGCGTGACAAATTCAGTTCATTCTTACGATGTGCTGACCAGGAAATG...

Protein

Download Protein FASTA

881 aa · LXL04_037018|LXL04_037018|OH1004|PROTEIN

MGSKPWLQPAPTYHPLETYWDTEEDAPGPRCAHTLTAVAQTKAHGPRLILFGGATAIEGGASSPVPGIRLAGVTNSVHSYDVLTRKWTRIKPAGEPPSPRAAHAAAVVGTMVVFQGGIGPAGHSTDDLYVLDMTNDKYKWHRLVVQGQGPGPRYGHVMDLVAQRYLVTVSGNDGKRVLSDAWALDTAQKPYAWQKLNPEGDKPSARMYATASARSDGMFLLCGGRDTSGTPLADAYGLLMHRNGQWEWTLAPGVSPSSRY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_037018
TK1151 IDTkA04G010450
OH-1004 IDLXL04_037018
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_037018
LocationChr08:51775754-51780181 (+)
DescriptionSimilar to BSL1: Serine/threonine-protein phosphatase BSL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g03080 Phosphatase involved in elongation process, probably by acting as a regulator of brassinolide signaling. No verified direct reference in this release
At2g27210 Phosphatase involved in elongation process, probably by acting as a regulator of brassinolide signaling. No verified direct reference in this release
At1g08420 Phosphatase involved in elongation process, probably by acting as a regulator of brassinolide signaling. No verified direct reference in this release
At1g03445 Phosphatase that acts as a positive regulator of brassinosteroid (BR) signaling.
Nuclear protein phosphatases with Kelch-repeat domains modulate the response to brassinosteroids in Arabidopsis.2004 · DOI: 10.1101/gad.1174204

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0144400 Serine/threonine-protein phosphatase BSL1 homolog. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037018 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0032880 regulation of protein localization Biological Process
GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005777 peroxisome Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004722 protein serine/threonine phosphatase activity Molecular Function
GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G03445
ath:AT1G08420
ath:AT2G27210
ath:AT4G03080
dosa:Os05g0144400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.619
Rank 1 · LXL04_037018 · OH-1004
Nucleus0.352
Rank 2 · LXL04_037018 · OH-1004
Cell membrane0.160
Rank 3 · LXL04_037018 · OH-1004
Lysosome / Vacuole0.059
Rank 4 · LXL04_037018 · OH-1004
Golgi apparatus0.056
Rank 5 · LXL04_037018 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC721-223 aa
PF13415.13Beta-prop_FBX4222-188 aa
PF13854.13Kelch_HCF71-346 aa
PF24981.2Beta-prop_ATRN-LZTR174-352 aa
PF13415.13Beta-prop_FBX42178-356 aa
PF24681.2Kelch_KLHDC2_KLHL20_DRC7192-355 aa
PF13418.13Beta-prop_TYW4203-280 aa
PF16891.11STPPase_N529-576 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_037018PF24681.2Kelch_KLHDC2_KLHL20_DRC7212237.1e-46157.0
LXL04_037018PF13415.13Beta-prop_FBX42221882.4e-37129.3
LXL04_037018PF13854.13Kelch_HCF713462.9e-1867.0
LXL04_037018PF24981.2Beta-prop_ATRN-LZTR1743529.4e-2278.3
LXL04_037018PF13415.13Beta-prop_FBX421783562.4e-37129.3
LXL04_037018PF24681.2Kelch_KLHDC2_KLHL20_DRC71923557.1e-46157.0
LXL04_037018PF13418.13Beta-prop_TYW42032805.8e-0937.0
LXL04_037018PF16891.11STPPase_N5295764.4e-0627.8
LXL04_037018PF00149.34Metallophos5787853.9e-38132.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8L7U5Arabidopsis thalianaSerine/threonine-protein phosphatase BSL181.532%Swiss-Protstrong database homology
Q9SHS7Arabidopsis thalianaSerine/threonine-protein phosphatase BSL363.141%Swiss-Protstrong database homology
Q9SJF0Arabidopsis thalianaSerine/threonine-protein phosphatase BSL262.821%Swiss-Protstrong database homology
Q9LR78Arabidopsis thalianaSerine/threonine-protein phosphatase BSU153.023%Swiss-Protstrong database homology
Q60EX6Oryza sativa subsp. japonicaSerine/threonine-protein phosphatase BSL1 homolog77.365%Swiss-Protstrong database homology

JBrowse

View in Genome Browser