LXL04_036694 | RubberDandelionOmics

Gene overview

LXL04_036694

Reference: OH-1004 Chr: Chr08 Coordinates: 46738123-46739186 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_036694|LXL04_036694|OH1004|cDNA

ATGGCTTCCGATCAGCCAATTTGCGATGGAAGCCTCTCATCAACAGATTTCCAGAACGCTGCTAACGCTTTTGCTGAGAAATGGAAGAAGTTCAATTCTGGTTTACCCGAGTGGACATGGATTGACTGCTCAAACAGATTAGGGTTCGCAGCTCATGGAATTAGCGATGGATATTTATCCTTACAGAATACGTTCATTCCGAGATCCGTCAAGGAAGACCACGATGAAGTCAACTCCAATGATAACCAAGAACATTTCGA...

CDS

Download CDS FASTA

651 bp · LXL04_036694|LXL04_036694|OH1004|CDS

ATGGCTTCCGATCAGCCAATTTGCGATGGAAGCCTCTCATCAACAGATTTCCAGAACGCTGCTAACGCTTTTGCTGAGAAATGGAAGAAGTTCAATTCTGGTTTACCCGAGTGGACATGGATTGACTGCTCAAACAGATTAGGGTTCGCAGCTCATGGAATTAGCGATGGATATTTATCCTTACAGAATACGTTCATTCCGAGATCCGTCAAGGAAGACCACGATGAAGTCAACTCCAATGATAACCAAGAACATTTCGA...

Protein

Download Protein FASTA

216 aa · LXL04_036694|LXL04_036694|OH1004|PROTEIN

MASDQPICDGSLSSTDFQNAANAFAEKWKKFNSGLPEWTWIDCSNRLGFAAHGISDGYLSLQNTFIPRSVKEDHDEVNSNDNQEHFDSATLVWNNISDDGDRFDFHVVYSHSYRVPVLYFNAQTSDGQPLNQDEIEKSLPIKSSEMLMESKWTFITQQEHPYLNRPWYMLHPCGTSEWMKLLLVGHSSTNQYLISWFSVVGQVFGLKLPFEMFEKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036694`
TK1151 ID	TkA04G028900
OH-1004 ID	LXL04_036694
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.400 / OH-1004 56.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036694

Location Chr08:46738123-46739186 (+)

Description Similar to ATG10: Ubiquitin-like-conjugating enzyme ATG10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07525`	E2-like enzyme involved in autophagy.	The ATG12-conjugating enzyme ATG10 Is essential for autophagic vesicle formation in Arabidopsis thaliana.2008 · DOI: 10.1534/genetics.107.086199 Autophagy differentially controls plant basal immunity to biotrophic and necrotrophic pathogens.2011 · DOI: 10.1111/j.1365-313x.2011.04546.x ATG2, an autophagy-related protein, negatively affects powdery mildew resistance and mildew-induced cell death in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04669.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036694 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000423 mitophagy Biological Process

GO:0006497 protein lipidation Biological Process

GO:0006914 autophagy Biological Process

GO:0006983 ER overload response Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0015031 protein transport Biological Process

GO:0031401 positive regulation of protein modification process Biological Process

GO:0032446 protein modification by small protein conjugation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043482 cellular pigment accumulation Biological Process

GO:0044804 nucleophagy Biological Process

KEGG gene cross-reference

ath:AT3G07525

ddi:DDB_G0268840

hsa:83734

mmu:66795

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.600

Rank 1 · LXL04_036694 · OH-1004

Cytoplasm0.512

Rank 2 · LXL04_036694 · OH-1004

Golgi apparatus0.044

Rank 3 · LXL04_036694 · OH-1004

Cell membrane0.043

Rank 4 · LXL04_036694 · OH-1004

Lysosome / Vacuole0.039

Rank 5 · LXL04_036694 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03987.21Autophagy_act_C16-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036694	`PF03987.21`	Autophagy_act_C	16	209	1.7e-42	146.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZ52`	Arabidopsis thaliana	Ubiquitin-like-conjugating enzyme ATG10	45.133%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card