RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_036686
Reference: OH-1004 Chr: Chr08 Coordinates: 46685001-46689107 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4026 bp · LXL04_036686|LXL04_036686|OH1004|cDNA

ATGTGGATCACCTCCCCCAAAATTAGCCTTCCCATGCACACTCTAACCATACTGATGATGCTTGCTTTCGTGGTAGCAGTCCCATGTCCTACTATAGATACTCAAGATTCAACTTATAGTTGGATTAAATTCACTTGCAACAACGGAAGTGTGGTTGAGCTAGACATCCATAGTTGTGATGAAAGTGAACTAAAAAAGGTAACATTTTCCTCATTTCCGAGCCTTAAGAGGCTAGATATTGTAGATAGTAATCTTGAAGT...

CDS

Download CDS FASTA

4026 bp · LXL04_036686|LXL04_036686|OH1004|CDS

ATGTGGATCACCTCCCCCAAAATTAGCCTTCCCATGCACACTCTAACCATACTGATGATGCTTGCTTTCGTGGTAGCAGTCCCATGTCCTACTATAGATACTCAAGATTCAACTTATAGTTGGATTAAATTCACTTGCAACAACGGAAGTGTGGTTGAGCTAGACATCCATAGTTGTGATGAAAGTGAACTAAAAAAGGTAACATTTTCCTCATTTCCGAGCCTTAAGAGGCTAGATATTGTAGATAGTAATCTTGAAGT...

Protein

Download Protein FASTA

1341 aa · LXL04_036686|LXL04_036686|OH1004|PROTEIN

MWITSPKISLPMHTLTILMMLAFVVAVPCPTIDTQDSTYSWIKFTCNNGSVVELDIHSCDESELKKVTFSSFPSLKRLDIVDSNLEVNILYKIGLLPNLTHVSLRQNGLIGTLPLFFTNLTRLQYLDLSDNSFNGTIPSQLWSLKSLEYLDLSQNWFTGPIFRSSNFRIDLSRLLHLNLSGNSLNGIIPSQLWSLKNLTYLDLSQNSLTGPLLQSPDSIIYLARLLHLNLSGNYFNGTIPSQLWSLKNLEYLDLSQNLLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_036686
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_036686
LocationChr08:46685001-46689107 (+)
DescriptionSimilar to MIK2: MDIS1-interacting receptor like kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g08850 Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.
A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y
The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w
The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808
At1g35710 Probable leucine-rich repeat receptor-like protein kinase At1g35710. No verified direct reference in this release
At5g44700 Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x
The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066
A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
At5g07280 Receptor with a serine/threonine-protein kinase activity required for the specification of the correct number of male archesporial initials and for the subsequent specification of tapetal and middle cell layer identities. No verified direct reference in this release
At1g17230 Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036686 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0002213 defense response to insect Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0009695 jasmonic acid biosynthetic process Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009759 indole glucosinolate biosynthetic process Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0031349 positive regulation of defense response Biological Process
GO:0080027 response to herbivore Biological Process
GO:1901653 cellular response to peptide Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0090406 pollen tube Cellular Component
KEGG gene cross-reference
ath:AT1G35710
ath:AT4G08850
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.750
Rank 1 · LXL04_036686 · OH-1004
Endoplasmic reticulum0.107
Rank 2 · LXL04_036686 · OH-1004
Cytoplasm0.081
Rank 3 · LXL04_036686 · OH-1004
Lysosome / Vacuole0.070
Rank 4 · LXL04_036686 · OH-1004
Nucleus0.047
Rank 5 · LXL04_036686 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_897-155 aa
PF12799.14LRR_497-134 aa
PF12799.14LRR_4121-155 aa
PF13855.13LRR_8170-208 aa
PF13855.13LRR_8218-259 aa
PF13855.13LRR_8321-361 aa
PF13855.13LRR_8420-460 aa
PF13855.13LRR_8529-564 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_036686PF13855.13LRR_8971554.7e-75248.0
LXL04_036686PF12799.14LRR_4971345e-64211.6
LXL04_036686PF12799.14LRR_41211555e-64211.6
LXL04_036686PF13855.13LRR_81702084.7e-75248.0
LXL04_036686PF13855.13LRR_82182594.7e-75248.0
LXL04_036686PF13855.13LRR_83213614.7e-75248.0
LXL04_036686PF13855.13LRR_84204604.7e-75248.0
LXL04_036686PF13855.13LRR_85295644.7e-75248.0
LXL04_036686PF13855.13LRR_85796174.7e-75248.0
LXL04_036686PF13855.13LRR_86296684.7e-75248.0
LXL04_036686PF13855.13LRR_86787194.7e-75248.0
LXL04_036686PF13855.13LRR_87868444.7e-75248.0
LXL04_036686PF12799.14LRR_48098455e-64211.6
LXL04_036686PF12799.14LRR_48809165e-64211.6
LXL04_036686PF12799.14LRR_49279585e-64211.6
LXL04_036686PF07714.24PK_Tyr_Ser-Thr108113355.7e-43147.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8VZG8Arabidopsis thalianaMDIS1-interacting receptor like kinase 238.289%Swiss-Protmoderate database homology
Q9LP24Arabidopsis thalianaProbable leucine-rich repeat receptor-like protein kinase At1g3571035.668%Swiss-Protmoderate database homology
Q9FIZ3Arabidopsis thalianaLRR receptor-like serine/threonine-protein kinase GSO233.041%Swiss-Protmoderate database homology
Q9LYN8Arabidopsis thalianaLeucine-rich repeat receptor protein kinase EMS133.361%Swiss-Protmoderate database homology
Q9SHI2Arabidopsis thalianaLeucine-rich repeat receptor-like serine/threonine-protein kinase At1g1723033.721%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser