LXL04_036657 | RubberDandelionOmics

Gene overview

LXL04_036657

Reference: OH-1004 Chr: Chr08 Coordinates: 46317543-46330133 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5724 bp · LXL04_036657|LXL04_036657|OH1004|cDNA

ATGGCCGATTACGTCACCACCTTCATCTGGCACCAGCTTACAATCGCTTACCAGTTCAAGCTTTTGCCTTTTTTTACTTCTTCTCTTCTCACCACCAAATCCCACATAAGTTTACCGAAGAACATTCAACAAGGTTCGCCTAATCACAGAGACGGGTCAACAACCCTCATAATTTGTCAACGACAATTACAGGCGTACCCATGTGAACACATCAACATTCTCGGGATGTCCGAATTAAGAATTTTAGGGTTCATCACGTT...

CDS

Download CDS FASTA

5724 bp · LXL04_036657|LXL04_036657|OH1004|CDS

ATGGCCGATTACGTCACCACCTTCATCTGGCACCAGCTTACAATCGCTTACCAGTTCAAGCTTTTGCCTTTTTTTACTTCTTCTCTTCTCACCACCAAATCCCACATAAGTTTACCGAAGAACATTCAACAAGGTTCGCCTAATCACAGAGACGGGTCAACAACCCTCATAATTTGTCAACGACAATTACAGGCGTACCCATGTGAACACATCAACATTCTCGGGATGTCCGAATTAAGAATTTTAGGGTTCATCACGTT...

Protein

Download Protein FASTA

1907 aa · LXL04_036657|LXL04_036657|OH1004|PROTEIN

MADYVTTFIWHQLTIAYQFKLLPFFTSSLLTTKSHISLPKNIQQGSPNHRDGSTTLIICQRQLQAYPCEHINILGMSELRILGFITFLAISLLLAVTDSQSTHPTEVTALQVIKESLIDSDNRLSNWDRGDPCVSNWTGVLCFNRTLDDSYLHVRELQLLNLKLEGTLSPAIGRLSFMQILDVMWNNISGSIPKEIGQLTNLELLLLNGNQLTGSLPEEIGYLPNLDRIQIDQNHISGSIPVSFANLNKTKHFHMNNNSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036657`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036657

Location Chr08:46317543-46330133 (+)

Description Similar to At1g06840: Probable LRR receptor-like serine/threonine-protein kinase At1g06840

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06840`	Probable LRR receptor-like serine/threonine-protein kinase At1g06840.	No verified direct reference in this release
`At5g37450`	Probable LRR receptor-like serine/threonine-protein kinase At5g37450.	No verified direct reference in this release
`At3g53590`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590.	No verified direct reference in this release
`At5g49760`	Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.	Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
`At5g49770`	Probable leucine-rich repeat receptor-like protein kinase At5g49770.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036657 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045088 regulation of innate immune response Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06840

ath:AT5G37450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.775

Rank 1 · LXL04_036657 · OH-1004

Cytoplasm0.096

Rank 2 · LXL04_036657 · OH-1004

Endoplasmic reticulum0.091

Rank 3 · LXL04_036657 · OH-1004

Nucleus0.051

Rank 4 · LXL04_036657 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_036657 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_2104-142 aa

PF23598.2LRR_14152-233 aa

PF13855.13LRR_8224-284 aa

PF13855.13LRR_8343-402 aa

PF13855.13LRR_8369-402 aa

PF12799.14LRR_4369-402 aa

PF00069.32Pkinase697-961 aa

PF07714.24PK_Tyr_Ser-Thr698-963 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036657	`PF08263.18`	LRRNT_2	104	142	3.6e-21	75.9
LXL04_036657	`PF23598.2`	LRR_14	152	233	2.7e-17	63.3
LXL04_036657	`PF13855.13`	LRR_8	224	284	5.2e-25	87.7
LXL04_036657	`PF13855.13`	LRR_8	343	402	5.2e-25	87.7
LXL04_036657	`PF13855.13`	LRR_8	369	402	5.2e-25	87.7
LXL04_036657	`PF12799.14`	LRR_4	369	402	4.7e-21	75.1
LXL04_036657	`PF00069.32`	Pkinase	697	961	2.9e-95	319.4
LXL04_036657	`PF07714.24`	PK_Tyr_Ser-Thr	698	963	1.6e-94	316.7
LXL04_036657	`PF08263.18`	LRRNT_2	1020	1059	3.6e-21	75.9
LXL04_036657	`PF23598.2`	LRR_14	1070	1149	2.7e-17	63.3
LXL04_036657	`PF13855.13`	LRR_8	1141	1201	5.2e-25	87.7
LXL04_036657	`PF13855.13`	LRR_8	1238	1296	5.2e-25	87.7
LXL04_036657	`PF12799.14`	LRR_4	1261	1296	4.7e-21	75.1
LXL04_036657	`PF00069.32`	Pkinase	1581	1847	2.9e-95	319.4
LXL04_036657	`PF07714.24`	PK_Tyr_Ser-Thr	1583	1849	1.6e-94	316.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGD7`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g06840	66.703%	Swiss-Prot	weak database homology
`C0LGU1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g37450	51.475%	Swiss-Prot	weak database homology
`Q9LFG1`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	53.036%	Swiss-Prot	weak database homology
`Q8GZ99`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase HPCA1	37.006%	Swiss-Prot	weak database homology
`Q9LT96`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g49770	36.220%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card