LXL04_036656 | RubberDandelionOmics

Gene overview

LXL04_036656

Reference: OH-1004 Chr: Chr08 Coordinates: 46279853-46282324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · LXL04_036656|LXL04_036656|OH1004|cDNA

ATGGCTGCTTATGCCAAGAACACTAATAGAGTTTCTCTTGCAATAGAGAGAACAGGACAATGGGTTTTTTCTCAAGATATCCCAACTGATATTCTTATACAAGTTGGTGAAGCAAAGTTTCCTCTGCACAAGTTCATGTTAGTAGCAAAGAGCAATTACATAAGAAGATTAATACTGGAATCGAAAGAACCTGATTTGGCAAAGCTAGACCTCTCGAGTATTCCTGGAGGAGCTGAGATCTTCGAGAAGGCAGCAAAGTT...

CDS

Download CDS FASTA

1734 bp · LXL04_036656|LXL04_036656|OH1004|CDS

ATGGCTGCTTATGCCAAGAACACTAATAGAGTTTCTCTTGCAATAGAGAGAACAGGACAATGGGTTTTTTCTCAAGATATCCCAACTGATATTCTTATACAAGTTGGTGAAGCAAAGTTTCCTCTGCACAAGTTCATGTTAGTAGCAAAGAGCAATTACATAAGAAGATTAATACTGGAATCGAAAGAACCTGATTTGGCAAAGCTAGACCTCTCGAGTATTCCTGGAGGAGCTGAGATCTTCGAGAAGGCAGCAAAGTT...

Protein

Download Protein FASTA

577 aa · LXL04_036656|LXL04_036656|OH1004|PROTEIN

MAAYAKNTNRVSLAIERTGQWVFSQDIPTDILIQVGEAKFPLHKFMLVAKSNYIRRLILESKEPDLAKLDLSSIPGGAEIFEKAAKFCYGVNFEITVHNVAALRCAAEYLDMTDQYCDGNLAGRTDDFLVQVALTSLSGAVVVLKSCEDLLPIAEQINIIQRCVEVASAKACNEANFPSRSPPNWWTEELSIVHIHFFEKIIASMKARGAKPLTIASAIITYTERALPGLVRDHSGTSIKTSISIDSASRNQQRELLESI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036656`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036656

Location Chr08:46279853-46282324 (-)

Description Similar to RPT2: Root phototropism protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q682S0`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	No verified direct reference in this release
`At5g67385`	Acts as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (Probable).	No verified direct reference in this release
`At5g48800`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g03010`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At2g47860`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036656 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009638 phototropism Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G03010

ath:AT2G30520

ath:AT2G47860

ath:AT5G48800

ath:AT5G67385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · LXL04_036656 · OH-1004

Nucleus0.383

Rank 2 · LXL04_036656 · OH-1004

Cell membrane0.229

Rank 3 · LXL04_036656 · OH-1004

Endoplasmic reticulum0.049

Rank 4 · LXL04_036656 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_036656 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB24-114 aa

PF03000.20NPH3184-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036656	`PF00651.38`	BTB	24	114	2.9e-09	37.8
LXL04_036656	`PF03000.20`	NPH3	184	440	1e-77	262.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q682S0`	Arabidopsis thaliana	Root phototropism protein 2	66.724%	Swiss-Prot	strong database homology
`Q66GP0`	Arabidopsis thaliana	BTB/POZ domain-containing protein SR1IP1	36.876%	Swiss-Prot	moderate database homology
`Q9FKB6`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g48800	37.522%	Swiss-Prot	moderate database homology
`Q9SA69`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g03010	32.888%	Swiss-Prot	moderate database homology
`O82253`	Arabidopsis thaliana	BTB/POZ domain-containing protein SETH6	34.211%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card