LXL04_036653 | RubberDandelionOmics

Gene overview

LXL04_036653

Reference: OH-1004 Chr: Chr08 Coordinates: 46194521-46200569 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2145 bp · LXL04_036653|LXL04_036653|OH1004|cDNA

ATGTCGAATCACGGAACGACAAAACGATTCTTGATCCGAGAAATGGATCGAAGCATCAAACAAATGATGAAGCTAgttgaagaagaaggagattCATTCGCCAAGAAAGCTGAAATTTATTGCCAGAAGAGACCAAAACTCGTATCTCATGTCGAAGAATTTTACCGAATGTTCCGATCATTGGCCGAGCGTTACCATGAAGCCAAAGTCGAGTTGAGGAAGTACCGGCCCCCTACGGACCTCCGATCACAAAGCTCACT...

CDS

Download CDS FASTA

2145 bp · LXL04_036653|LXL04_036653|OH1004|CDS

ATGTCGAATCACGGAACGACAAAACGATTCTTGATCCGAGAAATGGATCGAAGCATCAAACAAATGATGAAGCTAGTTGAAGAAGAAGGAGATTCATTCGCCAAGAAAGCTGAAATTTATTGCCAGAAGAGACCAAAACTCGTATCTCATGTCGAAGAATTTTACCGAATGTTCCGATCATTGGCCGAGCGTTACCATGAAGCCAAAGTCGAGTTGAGGAAGTACCGGCCCCCTACGGACCTCCGATCACAAAGCTCACT...

Protein

Download Protein FASTA

714 aa · LXL04_036653|LXL04_036653|OH1004|PROTEIN

MSNHGTTKRFLIREMDRSIKQMMKLVEEEGDSFAKKAEIYCQKRPKLVSHVEEFYRMFRSLAERYHEAKVELRKYRPPTDLRSQSSLNFDVFSEPPSAMTSPDRRLSRRLSEIPNFDYFKAGYETPTNESESDSDDSIIQSYSNSSNYRRLRKKIVELEAELRKVQMEHEENRSNSEIEYYAEELRMANEKITSLEEEIDRLRMKLQNYESFEHSRDDISDESVDDFETPRVTDRLAEDALEQEVKRFRRELDLKHLDGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036653`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036653

Location Chr08:46194521-46200569 (-)

Description Similar to NET4B: Protein NETWORKED 4B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30500`	Plant-specific actin binding protein.	No verified direct reference in this release
`At5g58320`	Plant-specific actin binding protein.	No verified direct reference in this release
`At4g14760`	Plant-specific actin binding protein.	No verified direct reference in this release
`At3g22790`	Plant-specific actin binding protein.	A superfamily of actin-binding proteins at the actin-membrane nexus of higher plants.2012 · DOI: 10.1016/j.cub.2012.06.041
`At1g03080`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G03080

ath:AT2G30500

ath:AT3G22790

ath:AT4G14760

ath:AT5G58320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · LXL04_036653 · OH-1004

Nucleus0.366

Rank 2 · LXL04_036653 · OH-1004

Cell membrane0.139

Rank 3 · LXL04_036653 · OH-1004

Mitochondrion0.070

Rank 4 · LXL04_036653 · OH-1004

Golgi apparatus0.055

Rank 5 · LXL04_036653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07765.18KIP112-65 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036653	`PF07765.18`	KIP1	12	65	7.1e-21	74.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84VY2`	Arabidopsis thaliana	Protein NETWORKED 4B	28.543%	Swiss-Prot	weak database homology
`F4KEW8`	Arabidopsis thaliana	Protein NETWORKED 4A	37.712%	Swiss-Prot	weak database homology
`F4JIF4`	Arabidopsis thaliana	Protein NETWORKED 1B	29.560%	Swiss-Prot	weak database homology
`Q9LUI2`	Arabidopsis thaliana	Protein NETWORKED 1A	25.140%	Swiss-Prot	weak database homology
`F4HZB5`	Arabidopsis thaliana	Protein NETWORKED 1D	53.226%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card