Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1404 bp · LXL04_036643|LXL04_036643|OH1004|cDNA
ATGGACAACGACGTATCTGGATGGATTCTTGAATTCCTTCTCGGCCAAAGTTCACTCGACAATCGTACATTAGATAATCTAATCCGCGTTCTTCCACTTCCCAACAACAATCCGAGACTGAAAAAGAGGTTACTCCTGCGAAAAATCGAGATGGATATCAAGACCAGCACAATTTCTGACCGAACAATCGAGTTTCTCGAGCAAATCGAAGAACTGGACCTCATAGAAGGCTCCCTCGAGGTTTCTGAAGCCATGAAGAC...
1404 bp · LXL04_036643|LXL04_036643|OH1004|CDS
ATGGACAACGACGTATCTGGATGGATTCTTGAATTCCTTCTCGGCCAAAGTTCACTCGACAATCGTACATTAGATAATCTAATCCGCGTTCTTCCACTTCCCAACAACAATCCGAGACTGAAAAAGAGGTTACTCCTGCGAAAAATCGAGATGGATATCAAGACCAGCACAATTTCTGACCGAACAATCGAGTTTCTCGAGCAAATCGAAGAACTGGACCTCATAGAAGGCTCCCTCGAGGTTTCTGAAGCCATGAAGAC...
Protein
Download Protein FASTA467 aa · LXL04_036643|LXL04_036643|OH1004|PROTEIN
MDNDVSGWILEFLLGQSSLDNRTLDNLIRVLPLPNNNPRLKKRLLLRKIEMDIKTSTISDRTIEFLEQIEELDLIEGSLEVSEAMKTAYCTLAMYCTAKSLQESSGDPKEKYTNAMSRIWSGRVREIEISEVAKTVGLVEDDLLHWVNDIEAGVLNADICENVLEKFRTLDVLDVLRRYVDDAKEKMGPSFIELACETISKDDELSKIMGLNSITNQIEDSTPTVSQDADVNTNSKGNEEAIQETRVLLLPKHKPAGPRC...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_036643 |
|---|---|
| TK1151 ID | TkA04G032660 |
| OH-1004 ID | LXL04_036643 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_036643 |
|---|---|
| Location | Chr08:45856184-45859470 (+) |
| Description | Similar to TERF1: Telomeric repeat-binding factor 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0006334 nucleosome assembly Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0008156 negative regulation of DNA replication Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0016233 telomere capping Biological Process GO:0032206 positive regulation of telomere maintenance Biological Process GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process GO:0032214 negative regulation of telomere maintenance via semi-conservative replication Biological Process GO:0051301 cell division Biological Process GO:0061820 telomeric D-loop disassembly Biological Process |
| KEGG gene cross-reference | hsa:7013 zma:542123 zma:542124 zma:542125 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00249.38Myb_DNA-binding415-464 aaPF13921.13Myb_DNA-bind_6418-464 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_036643 | PF00249.38 | Myb_DNA-binding | 415 | 464 | 7.3e-09 | 36.3 |
| LXL04_036643 | PF13921.13 | Myb_DNA-bind_6 | 418 | 464 | 7.9e-06 | 26.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.